KEGG   Pseudomonas fulva: Psefu_0590Help
Entry
Psefu_0590        CDS       T01501                                 

Definition
glycoside hydrolase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
pfv  Pseudomonas fulva
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Psefu_0590
Enzymes [BR:pfv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Psefu_0590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
657918..659054
Genome map
AA seq 378 aa AA seqDB search
MAIKTFDQMAAAGEFPLIGFNAAGLGNNPYVDPIATAKLDTHYFTVAPRGHQPDYIKSYA
GSIGGKPFAVRLPFAGERIAILDGAGGFTLRQSYVEEIRKAIRHIHSWGGFSLLDMHNYC
RWYVRANGPVSGRVVQAWNGGYALWTAIGAPDCPVNYTLLARIWAAIAREFRDEPGVFGY
GLMNEPHNLGSVPDGGVNVETLWTNNVQRLITAVREVDPRHFITVAGNSFASALYWPRSS
DALKNLQDPGGRLLYEAHQYPDKEGQGGGKWTQANESIVYRERVADWYPFIDWLKANGKR
GIAGEFGGPDHVPGMRTYFTELHKYFDANHILRFQWLAGPGDADDAPNGMDRNDGTLKPN
TRSLMARIGNTTTAYGPR
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggctatcaaaacctttgaccaaatggccgctgccggcgaattcccgctgatcggcttc
aacgctgcgggtctcggcaacaacccctacgtcgaccccatcgccacggcaaagctggac
acccactacttcaccgtcgccccacgcggccaccagccggattacatcaagtcctatgcg
ggcagcatcggcggcaaacccttcgccgtgcgcctgccattcgctggcgagcgtatcgcc
attctcgatggcgccggcggcttcaccttgcggcagagctatgtggaagagatccgcaag
gccatccgccatatccacagctggggcggcttctcgctgctcgatatgcacaactactgc
cgctggtacgtgcgcgccaatggcccggtgagcggccgtgtggtgcaggcgtggaacggc
ggctacgccctgtggacggccatcggcgcgcctgattgcccggtcaattacaccctgctg
gcacgtatctgggcggccatcgcccgggagtttcgtgacgagccgggggtgttcggctac
ggcctgatgaacgagccgcacaacctgggcagcgtgcccgatggcggggtcaacgtcgaa
accctgtggaccaacaacgtgcagcggctgatcaccgcggtgcgcgaggtcgacccgcga
cacttcatcaccgtggccggcaattccttcgcctcggccctgtattggccgcgcagttcg
gacgcgctcaagaacctgcaggaccctggaggccgcctgctctacgaggcgcaccagtac
cccgataaagaggggcagggaggaggcaagtggactcaggccaatgagtcgatcgtttac
cgcgagcgggtggccgactggtatcccttcatcgactggctcaaggccaacggcaagcgt
ggtatcgccggcgagttcggcgggccggatcacgtgcccggtatgcgcacctacttcacc
gagctgcacaagtatttcgatgccaaccacatcctgcgctttcagtggctggccggcccc
ggcgatgccgacgacgcgcccaacggcatggaccgcaacgacggcaccctcaaacccaac
acccgctcgctgatggcgcgtatcggcaacaccaccacggcctacggccctcgctga

DBGET integrated database retrieval system