KEGG   Pseudomonas fulva: Psefu_0922Help
Entry
Psefu_0922        CDS       T01501                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pfv  Pseudomonas fulva
Pathway
pfv00900  Terpenoid backbone biosynthesis
pfv01100  Metabolic pathways
pfv01110  Biosynthesis of secondary metabolites
pfv01130  Biosynthesis of antibiotics
Module
pfv_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:pfv00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Psefu_0922
Enzymes [BR:pfv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Psefu_0922
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C SPOR
Motif
Other DBs
NCBI-ProteinID: AEF20900
JGI: Psefu_0922
UniProt: F6A9T6
Position
complement(1001515..1002390)
Genome map
AA seq 291 aa AA seqDB search
MTTHAIPADAELTLPAPAKLNLMLHILGRRDDGYHELQTLFQFLDHGDELGFRRREDGVI
RLHTEIDGVPHDSNLIVRAAKQLQQQSGTRLGADIWLHKRLPMGGGIGGGSSDAATTLLG
LDHLWQLSWSEDRLAALGLGLGADVPVFVRGRAAFAEGVGEKLTPVELPERWFLVAVPQV
LVSTAEVFTDPELTRDTPPIKVRSLLEGGGRNDCQPVVEKRYPAVRNALILLNKFVPTRL
TGTGACVFGSFPNRDDADKVARQLPATLPSFVAQGANVSMLHRKLQELARK
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgcacgccattcccgctgacgccgagctgactctgccggctcctgccaagctc
aacctgatgctgcacattctcgggcgccgcgacgacggctatcacgagctgcagaccctg
tttcagtttctcgaccatggcgacgagctgggcttcaggcggcgcgaggacggcgtgatc
cgcctgcacaccgaaatcgacggcgtgccccacgacagcaacctgatcgtgcgcgccgca
aaacaattgcagcagcagagcggcactcgcctgggcgcggacatctggctgcacaagcgc
ctgcccatgggcggcggtatcggcggcggcagctcggatgccgccactaccctgctcggt
ctcgatcatctctggcaactgagctggagcgaggatcgcctggccgctctgggcctcggc
ctgggcgccgacgtgccggtcttcgtgcgtggccgcgcggcctttgccgaaggcgtgggt
gaaaaactcacgccggtcgagctgccggagcgctggtttctcgtcgctgtgccgcaagtg
cttgtcagcacagcagaagttttcaccgaccctgagttgacacgcgatacgccgcccatt
aaagttcgcagccttcttgaggggggtggtcgtaatgactgccagccggtcgtcgagaag
cgttacccagctgttcgtaacgcgctgatcttgctgaacaaatttgttccgacaagattg
accggcactggagcttgtgtgtttgggagcttcccaaaccgggacgatgctgataaagtc
gcccgccaacttccagccacactgccaagttttgttgcgcagggtgccaacgtttcgatg
ttgcaccgcaagctgcaagaactggccaggaagtga

DBGET integrated database retrieval system