KEGG   Pseudomonas fulva: Psefu_1047Help
Entry
Psefu_1047        CDS       T01501                                 

Definition
disulfide bond isomerase DsbC/G
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
pfv  Pseudomonas fulva
Brite
Enzymes [BR:pfv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Psefu_1047
Secretion system [BR:pfv02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Psefu_1047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1132572..1133297
Genome map
AA seq 241 aa AA seqDB search
MRVTRIVAAMALGLVSTLGHAADPDQAIRKNLLAIQPDLPIEAIAESPMPGVYQVQLKGG
RQLYASADGQFVMQGYLFQFKDGQAINLTEAEESKAIAKQINAIPAKDMVVFAPKEPKTH
ITVFTDTDCAYCQKLHSEVGELNKLGVEVRYLAFPRQGMGSKGAKDLASVWCSKDRQAAM
NKAKARESIPQVSCDNPVAQEYQLGQAIGVNGTPAIILENGKMIPGYQPAAQLAKLALEA
K
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtgacccgcatcgtcgcggccatggctctcggcctggtcagcaccctcggccat
gccgccgacccggatcaggcgatccgcaagaacctgcttgccatccagcccgatctgccg
atcgaagccattgccgaaagcccgatgccaggcgtttatcaggtgcagctcaagggcggc
cgccagctgtacgccagtgccgacgggcagttcgtgatgcagggctacctgttccagttc
aaggatggtcaggccatcaacctgaccgaggcggaagaaagcaaggccatcgccaagcag
atcaacgccattccggccaaggacatggtggtgttcgcgccgaaagagccgaagacccat
atcaccgtattcaccgataccgactgcgcttattgccagaagctgcatagcgaagtgggc
gaactgaacaagctcggcgtcgaggtgcgttacctggccttcccgcgtcaggggatgggc
agcaagggcgccaaggacctggccagcgtgtggtgctccaaggatcgccaggccgcgatg
aacaaggccaaggcccgtgaatctattcctcaggtcagctgcgacaacccggttgcgcag
gagtaccagctgggtcaggcgatcggtgtcaacggcacgccggcgatcatcctggaaaac
ggcaagatgattcccggttatcagcccgccgcgcagctggcgaagctggcgctggaagcc
aaatga

DBGET integrated database retrieval system