KEGG   Pseudomonas fulva: Psefu_1047Help
Entry
Psefu_1047        CDS       T01501                                 

Definition
disulfide bond isomerase DsbC/G
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
pfv  Pseudomonas fulva
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1132572..1133297
Genome map
AA seq 241 aa AA seqDB search
MRVTRIVAAMALGLVSTLGHAADPDQAIRKNLLAIQPDLPIEAIAESPMPGVYQVQLKGG
RQLYASADGQFVMQGYLFQFKDGQAINLTEAEESKAIAKQINAIPAKDMVVFAPKEPKTH
ITVFTDTDCAYCQKLHSEVGELNKLGVEVRYLAFPRQGMGSKGAKDLASVWCSKDRQAAM
NKAKARESIPQVSCDNPVAQEYQLGQAIGVNGTPAIILENGKMIPGYQPAAQLAKLALEA
K
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtgacccgcatcgtcgcggccatggctctcggcctggtcagcaccctcggccat
gccgccgacccggatcaggcgatccgcaagaacctgcttgccatccagcccgatctgccg
atcgaagccattgccgaaagcccgatgccaggcgtttatcaggtgcagctcaagggcggc
cgccagctgtacgccagtgccgacgggcagttcgtgatgcagggctacctgttccagttc
aaggatggtcaggccatcaacctgaccgaggcggaagaaagcaaggccatcgccaagcag
atcaacgccattccggccaaggacatggtggtgttcgcgccgaaagagccgaagacccat
atcaccgtattcaccgataccgactgcgcttattgccagaagctgcatagcgaagtgggc
gaactgaacaagctcggcgtcgaggtgcgttacctggccttcccgcgtcaggggatgggc
agcaagggcgccaaggacctggccagcgtgtggtgctccaaggatcgccaggccgcgatg
aacaaggccaaggcccgtgaatctattcctcaggtcagctgcgacaacccggttgcgcag
gagtaccagctgggtcaggcgatcggtgtcaacggcacgccggcgatcatcctggaaaac
ggcaagatgattcccggttatcagcccgccgcgcagctggcgaagctggcgctggaagcc
aaatga

DBGET integrated database retrieval system