KEGG   Pseudomonas fulva: Psefu_1049Help
Entry
Psefu_1049        CDS       T01501                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
pfv  Pseudomonas fulva
Pathway
pfv00260  Glycine, serine and threonine metabolism
pfv00750  Vitamin B6 metabolism
pfv01100  Metabolic pathways
pfv01110  Biosynthesis of secondary metabolites
pfv01120  Microbial metabolism in diverse environments
pfv01230  Biosynthesis of amino acids
Module
pfv_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pfv00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Psefu_1049
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Psefu_1049
Enzymes [BR:pfv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Psefu_1049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: AEF21027
JGI: Psefu_1049
UniProt: F6ABD9
Position
1134807..1136216
Genome map
AA seq 469 aa AA seqDB search
MRYISTRGQAPALNFEDVLLAGLATDGGLYVPENLPRFTQEEIASWAGLPYHELAFRVMR
PFVTGSIPDADFKKILEDTYGVFEHSAVAPLRQLNGNEWVLELFHGPTLAFKDFALQLLG
RLLDYVLAKRNERVVIMGATSGDTGSAAIEGCKACENVDIFIMHPHNRVSEVQRRQMTTI
LGDNIHNIAIEGNFDDCQEMVKASFADQGFLKGTRLVAVNSINWARIMAQIVYYFHAALQ
LGGPARSVAFSVPTGNFGDIFAGYLARNMGLPVSQLIVATNRNDILHRFMSGNQYAKGEL
YPTLSPSMDIMVSSNFERLLFDLHGRNGPSIAALMTEFRQTGGFTVEDDRWTEARKLFDS
LAVSDEQTCQTIAEVYAATGELLDPHTAIGVRAARECRRSLSVPMVVLGTAHPVKFPEAI
EKSAVDLSPALPAHLADLFEREERCTVLANDLPTVQQFVAAHGNRGKPL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcgctatatcagcactcgcggccaggctccggccctgaatttcgaagacgttctgctg
gccggcctggccacggacggcggcctgtacgtgccggaaaacctgccacgcttcactcag
gaagaaatcgcctcctgggccggcctgccgtatcacgagctggccttccgggtgatgcgt
ccgttcgtgaccggcagcattccggatgccgacttcaagaagatcctcgaagatacctac
ggcgtgttcgaacactcggccgtggcgccgctgcgtcagctgaacggcaacgagtgggtg
ctcgagctgttccatggcccgaccctggcgttcaaggatttcgccctgcagctgctcggt
cgtctgctcgactacgtgctggccaagcgcaacgagcgcgtggtgatcatgggcgccacc
agcggtgacaccggctcggccgccatcgaaggctgcaaggcctgcgagaacgtggacatc
ttcatcatgcacccgcacaaccgggtgtccgaagtgcagcgccggcagatgaccaccatt
ctcggcgacaacatccacaacatcgccatcgagggcaacttcgacgactgccaggagatg
gtcaaggccagcttcgccgaccagggcttcctcaaaggcacacgcctggtggcggtcaac
tcgatcaactgggcgcggatcatggcccagatcgtctactacttccacgcggccctgcag
ctcggcggtccggcgcgttcggtggccttctcggtgccgaccggcaacttcggcgacatc
ttcgccggctatctcgcccgcaacatgggcctgccggtcagccagctgatcgtcgccacc
aaccgcaacgatatcctgcatcgcttcatgagcggcaatcagtacgccaagggcgagctt
tacccgaccctgtcgccgtcgatggacatcatggtctcgtcgaacttcgagcgtctgctg
ttcgacctgcacggtcgcaatggtccatcgatcgccgcgctgatgaccgaattccgccag
accggcggcttcaccgtcgaagacgaccgctggaccgaggcgcgcaagctgttcgattcc
ctcgccgtgagcgatgagcagacctgtcagaccatcgccgaggtctacgccgccaccggc
gagctgcttgatccgcacaccgccattggtgtgcgtgctgcccgcgagtgccgtcgcagc
ctgtcggtgccgatggtggtgctgggcaccgcccatccggtcaagttcccggaagccatc
gagaagtccgccgtggatctgtcgccagcgttgccggcgcacctggccgatctgttcgag
cgtgaggagcgctgcaccgtgctggccaacgatctgccgaccgtgcagcaattcgtggcg
gcgcacggcaatcgcggcaagccgctgtaa

DBGET integrated database retrieval system