KEGG   Pseudomonas fulva: Psefu_1049Help
Entry
Psefu_1049        CDS       T01501                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pfv  Pseudomonas fulva
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pfv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Psefu_1049
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Psefu_1049
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Psefu_1049
Enzymes [BR:pfv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Psefu_1049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1134807..1136216
Genome map
AA seq 469 aa AA seqDB search
MRYISTRGQAPALNFEDVLLAGLATDGGLYVPENLPRFTQEEIASWAGLPYHELAFRVMR
PFVTGSIPDADFKKILEDTYGVFEHSAVAPLRQLNGNEWVLELFHGPTLAFKDFALQLLG
RLLDYVLAKRNERVVIMGATSGDTGSAAIEGCKACENVDIFIMHPHNRVSEVQRRQMTTI
LGDNIHNIAIEGNFDDCQEMVKASFADQGFLKGTRLVAVNSINWARIMAQIVYYFHAALQ
LGGPARSVAFSVPTGNFGDIFAGYLARNMGLPVSQLIVATNRNDILHRFMSGNQYAKGEL
YPTLSPSMDIMVSSNFERLLFDLHGRNGPSIAALMTEFRQTGGFTVEDDRWTEARKLFDS
LAVSDEQTCQTIAEVYAATGELLDPHTAIGVRAARECRRSLSVPMVVLGTAHPVKFPEAI
EKSAVDLSPALPAHLADLFEREERCTVLANDLPTVQQFVAAHGNRGKPL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcgctatatcagcactcgcggccaggctccggccctgaatttcgaagacgttctgctg
gccggcctggccacggacggcggcctgtacgtgccggaaaacctgccacgcttcactcag
gaagaaatcgcctcctgggccggcctgccgtatcacgagctggccttccgggtgatgcgt
ccgttcgtgaccggcagcattccggatgccgacttcaagaagatcctcgaagatacctac
ggcgtgttcgaacactcggccgtggcgccgctgcgtcagctgaacggcaacgagtgggtg
ctcgagctgttccatggcccgaccctggcgttcaaggatttcgccctgcagctgctcggt
cgtctgctcgactacgtgctggccaagcgcaacgagcgcgtggtgatcatgggcgccacc
agcggtgacaccggctcggccgccatcgaaggctgcaaggcctgcgagaacgtggacatc
ttcatcatgcacccgcacaaccgggtgtccgaagtgcagcgccggcagatgaccaccatt
ctcggcgacaacatccacaacatcgccatcgagggcaacttcgacgactgccaggagatg
gtcaaggccagcttcgccgaccagggcttcctcaaaggcacacgcctggtggcggtcaac
tcgatcaactgggcgcggatcatggcccagatcgtctactacttccacgcggccctgcag
ctcggcggtccggcgcgttcggtggccttctcggtgccgaccggcaacttcggcgacatc
ttcgccggctatctcgcccgcaacatgggcctgccggtcagccagctgatcgtcgccacc
aaccgcaacgatatcctgcatcgcttcatgagcggcaatcagtacgccaagggcgagctt
tacccgaccctgtcgccgtcgatggacatcatggtctcgtcgaacttcgagcgtctgctg
ttcgacctgcacggtcgcaatggtccatcgatcgccgcgctgatgaccgaattccgccag
accggcggcttcaccgtcgaagacgaccgctggaccgaggcgcgcaagctgttcgattcc
ctcgccgtgagcgatgagcagacctgtcagaccatcgccgaggtctacgccgccaccggc
gagctgcttgatccgcacaccgccattggtgtgcgtgctgcccgcgagtgccgtcgcagc
ctgtcggtgccgatggtggtgctgggcaccgcccatccggtcaagttcccggaagccatc
gagaagtccgccgtggatctgtcgccagcgttgccggcgcacctggccgatctgttcgag
cgtgaggagcgctgcaccgtgctggccaacgatctgccgaccgtgcagcaattcgtggcg
gcgcacggcaatcgcggcaagccgctgtaa

DBGET integrated database retrieval system