KEGG   Pseudomonas fulva: Psefu_1154Help
Entry
Psefu_1154        CDS       T01501                                 

Definition
chemotaxis protein CheB (EC:3.1.1.61)
Orthology
K13491  
two-component system, chemotaxis family, response regulator WspF [EC:3.1.1.61]
Organism
pfv  Pseudomonas fulva
Pathway
Two-component system
Module
WspE-WspRF (chemosensory) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:pfv00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Psefu_1154
Enzymes [BR:pfv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Psefu_1154
Two-component system [BR:pfv02022]
 CheA family
  WspE-WspRF [MD:M00509]
   Psefu_1154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1262975..1263976
Genome map
AA seq 333 aa AA seqDB search
MRIGIVNDMPLAVEAMRRALAQEPAHRIVWVAGNGAEGVACCQADTPDLVLMDLLMPVMD
GVEATRRIMAQTPCAVLIVSVDIEQYVNRVFEAMGHGALDAVNTPSLGGQSSEAAVLLRK
IQNIGWLIGQSSSRKPIAAAAAPANTAARRLVAIGASAGGPAALAVVLKQLPRNFDAAVM
LVQHVDEVFAAGMAEWLAGESALPVRLARDGEQPQPGLVLLAGTNNHMRLQRNGTLTYTA
EPRSHVYRPSIDVFFDSLVEHWTGEGIGVLLTGMGRDGAQGLKNMRNRGFTTIAQSQASC
AVYGMPKAAAELQAAKEILTLERIAPRIVELFG
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaggatcggaatcgtcaatgacatgccgctggcagtcgaggccatgcgccgtgcgctc
gcccaggagccggcccatcgcatcgtctgggtggcgggcaatggtgccgaaggcgtggcc
tgctgccaggccgacacgccggatctggtgttgatggacctgctgatgccggtcatggac
ggtgtcgaggcgacccggcggatcatggcgcagacgccctgcgcggtgctgatcgtctcg
gtggatatcgagcagtacgtcaaccgcgtgttcgaggccatgggccatggcgccctggac
gccgtcaacacgccgtcgcttggcgggcagagcagtgaagccgcggtgctgctgcgcaag
atccagaacatcggctggctgatcggccagagcagcagccgcaagccgattgccgcggca
gctgcgcctgccaacaccgccgcccgccgcctggtggccatcggcgcttcagccggtggg
ccggcggcgctggccgtggtgctcaagcaactgccgcgtaacttcgatgccgcggtcatg
ctggtgcagcatgtcgacgaagtattcgctgccggtatggccgaatggctggccggtgaa
tcggccctgccggtgcgcctggcccgcgatggcgaacagccgcagccggggctggtactg
ttggccggcaccaacaaccatatgcgcctgcagcgcaacggcaccctgacctataccgcc
gagccgcgtagccacgtgtaccggccgtccatcgacgtgttcttcgacagcctggtcgag
cactggacgggcgagggcattggcgtactgctcaccggcatgggtcgtgacggtgcccag
ggtttgaagaacatgcgcaaccgcggcttcaccaccatcgcccagagccaggccagctgc
gcggtgtacggcatgcccaaggccgccgccgaactgcaggcggccaaggaaatactcacg
ctggagcgcattgcgccgcgtatcgtcgaactgtttggctga

DBGET integrated database retrieval system