KEGG   Pseudomonas fulva: Psefu_1528Help
Entry
Psefu_1528        CDS       T01501                                 

Definition
Holliday junction ATP-dependent DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pfv  Pseudomonas fulva
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pfv00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Psefu_1528
Enzymes [BR:pfv01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Psefu_1528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1644628..1645233
Genome map
AA seq 201 aa AA seqDB search
MIGRLRGTLAEKQPPHLILDVNGLGYELEVPMTTLYRLPPVGEPLTLHTHLVVREDAHLL
YGFFEKRERELFRELIRLNGVGPKLALALMSGLEIDELVRCVQAQDTAALVKIPGVGKKT
AERLLVELKDRFKAWEAVPGMAPLVVEPRAGGAVSSAENDAVSALISLGYKPQEASRAVS
AVKEDGLSSEDMIRRALKGML
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtgatcggacgtttacgcggcaccctggcggaaaagcagccgccgcatttgattctggat
gtgaatggtctgggctatgagctggaagtccccatgaccacgttgtaccgtttgcccccc
gtaggtgagccgctgaccctgcacacccatctggtggtgcgcgaggatgctcatctgctg
tacggctttttcgagaagcgcgagcgtgagctgtttcgtgagctgatccgcctcaacggc
gtcggcccgaaactcgcactggcgctgatgtccgggttggaaatcgacgagctggtgcgc
tgcgtgcaggctcaggataccgccgcgctggtgaagattcccggcgttggcaagaagacc
gccgagcgtctgctggtcgagctcaaggatcgcttcaaggcctgggaagcggtgcctggc
atggcgccactggtggttgaacctcgtgctggaggcgcagtctcaagcgcggagaatgat
gcggtgagtgcgcttatctcgctgggctacaagcctcaggaagccagtcgcgccgtttcg
gcagtcaaagaagatggattgagtagtgaagacatgatccgccgcgcgctgaaaggaatg
ctctag

DBGET integrated database retrieval system