KEGG   Pseudomonas fulva: Psefu_1528Help
Entry
Psefu_1528        CDS       T01501                                 

Definition
(GenBank) Holliday junction ATP-dependent DNA helicase ruvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pfv  Pseudomonas fulva
Pathway
pfv03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:pfv00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Psefu_1528
Enzymes [BR:pfv01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Psefu_1528
DNA repair and recombination proteins [BR:pfv03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Psefu_1528
    RecFOR pathway proteins
     Psefu_1528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH IMS_HHH Transposase_20 HHH_8 5_3_exonuc
Motif
Other DBs
NCBI-ProteinID: AEF21504
JGI: Psefu_1528
UniProt: F6AGW6
Position
1644628..1645233
Genome map
AA seq 201 aa AA seqDB search
MIGRLRGTLAEKQPPHLILDVNGLGYELEVPMTTLYRLPPVGEPLTLHTHLVVREDAHLL
YGFFEKRERELFRELIRLNGVGPKLALALMSGLEIDELVRCVQAQDTAALVKIPGVGKKT
AERLLVELKDRFKAWEAVPGMAPLVVEPRAGGAVSSAENDAVSALISLGYKPQEASRAVS
AVKEDGLSSEDMIRRALKGML
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtgatcggacgtttacgcggcaccctggcggaaaagcagccgccgcatttgattctggat
gtgaatggtctgggctatgagctggaagtccccatgaccacgttgtaccgtttgcccccc
gtaggtgagccgctgaccctgcacacccatctggtggtgcgcgaggatgctcatctgctg
tacggctttttcgagaagcgcgagcgtgagctgtttcgtgagctgatccgcctcaacggc
gtcggcccgaaactcgcactggcgctgatgtccgggttggaaatcgacgagctggtgcgc
tgcgtgcaggctcaggataccgccgcgctggtgaagattcccggcgttggcaagaagacc
gccgagcgtctgctggtcgagctcaaggatcgcttcaaggcctgggaagcggtgcctggc
atggcgccactggtggttgaacctcgtgctggaggcgcagtctcaagcgcggagaatgat
gcggtgagtgcgcttatctcgctgggctacaagcctcaggaagccagtcgcgccgtttcg
gcagtcaaagaagatggattgagtagtgaagacatgatccgccgcgcgctgaaaggaatg
ctctag

DBGET integrated database retrieval system