KEGG   Pseudomonas fulva: Psefu_1593Help
Entry
Psefu_1593        CDS       T01501                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
pfv  Pseudomonas fulva
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pfv00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Psefu_1593
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Psefu_1593
Enzymes [BR:pfv01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Psefu_1593
Lipid biosynthesis proteins [BR:pfv01004]
 Desaturase
  First
   Psefu_1593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1710090..1711370
Genome map
AA seq 426 aa AA seqDB search
MNELPESLKQHRIRTANVASVLLGEVRYSPLKSLWLTGMFLAALIGGVATFSWAAFAVFL
LATGTVLLLGHSLGSHRKLIHDSYQCPKWLEYTLVYLGVQVGLAGPLGLLRQHDLRDYAQ
RLPECHDYLRHGRSFWVDGWWQLHCDLVLDSPPVLELEERIANDRFYQFLERTWMLQQLL
PALALFLIGGWGFVFWGVCARITAGVVGHWLIGYFAHNEGEMHYRVNGAAVQGRNIRYTS
LLTMGESWHNNHHAFPGSARLGLFPGEWDPGWWVLLLLKKIGLVWNLTEPSDLAIRAELE
ALDNQRLVGTNQCRREVNKDEPQASLCALLKLSLQARSPTVPLQLEGPAINISGTLLQTL
IGSGSRFTHSLNVQRLQLKIGGEQVSGLPALLLALSRRGRVLTGVCTCLMPLAFAFNWIR
GELESV
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaatgagttaccggagagcctcaagcaacatcgcatcagaacggcgaatgtcgccagc
gtactgctaggtgaggtccgttattcgcctctcaagtccctttggttgactggtatgttc
ctggcggcgctgataggtggcgtggccacgttcagttgggctgcgtttgcggtttttcta
ttagcgaccggtactgtgctgttgctggggcattcgctgggcagccaccgcaagttgatt
catgacagctaccagtgccccaaatggttggagtacacgctggtctatcttggcgtgcag
gtcggtctggccgggcctttggggctgctacgccagcatgatctgcgcgactacgcccaa
cggcttcccgagtgtcatgactacctgcgccatggtcgttcattctgggttgatggctgg
tggcagttgcactgcgatctggtgctcgacagcccgccggtgcttgagctcgaagagcgc
attgccaatgaccgcttctaccagtttcttgaacgcacctggatgctccagcagttgctg
ccagcgttggctctcttcctgattggcggttggggttttgtcttttggggtgtttgtgcc
cgcattactgccggcgttgttgggcattggctgatcggctacttcgcccataacgagggt
gagatgcactaccgggtgaacggtgctgcggtacagggtcgcaacatccgctacacctcg
ctgttgaccatgggcgagtcttggcacaacaaccaccatgcatttcctggctccgcacga
cttggactgtttccgggtgagtgggatcccggctggtgggtgttgctgctgttgaagaaa
atcgggttggtctggaacctcaccgagcctagcgacctggcgattcgagcggaactcgaa
gccctcgacaaccagcgtctcgtcggtaccaatcaatgccgccgtgaggtgaataaagat
gaaccgcaggcaagcctgtgtgcattgctcaaactatcgctgcaggctcgctcgcccacg
gtaccgttgcaactcgaaggaccggcgataaatatctcaggcacgctgctgcaaaccctt
atcggttccggctcacgcttcacgcattcactgaatgtccagcgtctacagctaaagatt
ggcggcgagcaggtatccggattgccggcgctgttgctagcattgtcgcgccgaggtcga
gttctgacaggtgtttgcacatgtctgatgccgctggcctttgccttcaactggatccga
ggggaactagagtctgtttag

DBGET integrated database retrieval system