KEGG   Pseudomonas fulva: Psefu_1738Help
Entry
Psefu_1738        CDS       T01501                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pfv  Pseudomonas fulva
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pfv00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Psefu_1738
Enzymes [BR:pfv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Psefu_1738
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1870086..1870994
Genome map
AA seq 302 aa AA seqDB search
MQGKVVVVGSLNMDLIVRAPRLPRGGETLTGHDFSTAAGGKGANQAVAAARLGAQVAMIG
CVGADAYGARLRTGLITEGIDCSAVSEIDGVPTGIASILVDDAGQNAIVIVAGGNGALTP
QHLSAQAQLLADAQVLIVQLEVPDATVEAAMMLGREAGCTVILNPAPVAGPLSAHWYGMA
DYLIPNESEAAALTGLPVGSPQSALPAARSLLQAGARRVLITLGAQGVLYADAERHAHFA
VAPVAAVDTTAAGDTFVGGFAAALAAGQPLEAAIALGQQAAALAVTRPGAQPSIPYRHEL
PA
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggcaaagtggtggtggtcggcagtttgaacatggacctgatcgtgcgtgcgcca
cgcctgccgcgcggaggtgaaaccctcaccgggcatgatttctccaccgccgccggcggc
aagggcgccaaccaggcggtggccgcggcgcgcctcggcgcccaggtggcgatgatcggc
tgcgtgggcgccgacgcctatggcgcacggctgcgcaccgggctgatcaccgaaggcatc
gactgctcggcggtcagcgaaatcgacggcgtgcccaccggcatcgcttcgattctggtg
gacgacgccggccagaacgccatcgttatcgtcgccggcggcaacggtgcgctgacccca
cagcacctgagcgcgcaagcgcagctgctggccgatgcccaggtgctgatcgtgcagctg
gaagtgccggacgccaccgtcgaggccgccatgatgctgggccgcgaggccggctgcacg
gtgatcctcaacccggcgcccgtggccgggccgctgtcggcccactggtatggaatggcc
gattacctgattcccaacgagagcgaggccgctgcgctgaccggcttgccggtgggctcg
ccccagtcggcgctgccggcagcgcgcagcctgctgcaggccggcgctcgccgcgtactg
atcaccctcggcgcccagggcgtgctgtacgccgacgccgagcgccatgcccatttcgcc
gtggcgccggtagccgccgtggacaccaccgcggccggcgacaccttcgtcggtggcttc
gccgcggccctggccgccggccagccgctggaagccgccatcgccctgggtcagcaggcc
gccgccctggcggttacccggccgggtgcacaaccttcgatcccttatcgtcacgagttg
cccgcatga

DBGET integrated database retrieval system