KEGG   Pseudomonas fulva: Psefu_1807Help
Entry
Psefu_1807        CDS       T01501                                 

Definition
cytochrome c class I
Orthology
K08738  
cytochrome c
Organism
pfv  Pseudomonas fulva
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:pfv00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:pfv02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1937602..1938018
Genome map
AA seq 138 aa AA seqDB search
MTVSVLIHLPSRRLLRHGLLIVASALFTQTALAEADIAAGEALFKRVCGNCHNVGPGARA
AFGPQLNGIFGRHAGATRDYKYSPAMQQAEVVWDHDTLSAFIKDSDSVVPGNKMRFWGIG
DQDKIDGLLLYLKAQQDH
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtttctgtactgattcatctgcctagccggcgtctcctgcgtcacggcttgctc
atcgtggcgagcgcgctgttcactcaaacggccctggccgaagccgacatcgctgccggc
gaggcattgttcaagcgcgtctgtggcaactgccacaacgttgggccgggcgcgcgggcg
gctttcgggccgcagctcaacggcatcttcgggcgccatgccggcgccacccgggactac
aagtattcgcccgccatgcagcaggcggaggtggtctgggatcacgacaccctgagcgcc
ttcatcaaggattccgacagcgtggtgccgggcaacaagatgcgcttctggggcattggc
gatcaggacaagatcgatggcctgctgctgtatctgaaggctcagcaggatcactga

DBGET integrated database retrieval system