KEGG   Pseudomonas fulva: Psefu_1887Help
Entry
Psefu_1887        CDS       T01501                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pfv  Pseudomonas fulva
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:pfv00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:pfv00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2022581..2023138
Genome map
AA seq 185 aa AA seqDB search
MRLSLFAVPLAMLALSAPLQAAECPALLADQGELPKLRSKDKIDLCEQFAGKPLMVVNTA
SFCGFTSQFEGLEALNKRYREQGLEILGVPSDSFKQESDDAAETAKVCFVNYGVTFTMSE
TQPVTGDKAIPLFKELARQTAAPRWNFFKYVVDRQGQVIARFSSLTKPDDPELIAAIEQA
IAPKP
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgcgactgtcactctttgccgtaccactggccatgctggcgttgagcgctccgctgcaa
gccgccgaatgtccggcgctgctggcggaccaaggcgagctgcccaagctgcgctccaag
gacaagatcgacctgtgcgagcagttcgccggcaagccgttgatggtggtcaataccgcc
agcttctgcggcttcacctcccagttcgaggggctggaagcgctcaacaagcgctatcgc
gagcaggggctggagattctgggtgtgccgtccgactcgttcaagcaggagtccgacgat
gccgcggaaaccgccaaggtctgcttcgtgaactacggcgtgacctttaccatgagcgaa
actcagcctgtgactggtgataaggctatcccgctgttcaaggaactggccaggcagacg
gccgcgccacgctggaatttcttcaagtatgtggtcgatcgccaggggcaggtgatcgcg
cggttttccagcctgaccaaaccggatgatcccgaactgatcgcggctatcgagcaggcg
attgctccaaagccttga

DBGET integrated database retrieval system