KEGG   Pseudomonas fulva: Psefu_1887Help
Entry
Psefu_1887        CDS       T01501                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pfv  Pseudomonas fulva
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pfv00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Psefu_1887
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Psefu_1887
Enzymes [BR:pfv01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Psefu_1887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2022581..2023138
Genome map
AA seq 185 aa AA seqDB search
MRLSLFAVPLAMLALSAPLQAAECPALLADQGELPKLRSKDKIDLCEQFAGKPLMVVNTA
SFCGFTSQFEGLEALNKRYREQGLEILGVPSDSFKQESDDAAETAKVCFVNYGVTFTMSE
TQPVTGDKAIPLFKELARQTAAPRWNFFKYVVDRQGQVIARFSSLTKPDDPELIAAIEQA
IAPKP
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgcgactgtcactctttgccgtaccactggccatgctggcgttgagcgctccgctgcaa
gccgccgaatgtccggcgctgctggcggaccaaggcgagctgcccaagctgcgctccaag
gacaagatcgacctgtgcgagcagttcgccggcaagccgttgatggtggtcaataccgcc
agcttctgcggcttcacctcccagttcgaggggctggaagcgctcaacaagcgctatcgc
gagcaggggctggagattctgggtgtgccgtccgactcgttcaagcaggagtccgacgat
gccgcggaaaccgccaaggtctgcttcgtgaactacggcgtgacctttaccatgagcgaa
actcagcctgtgactggtgataaggctatcccgctgttcaaggaactggccaggcagacg
gccgcgccacgctggaatttcttcaagtatgtggtcgatcgccaggggcaggtgatcgcg
cggttttccagcctgaccaaaccggatgatcccgaactgatcgcggctatcgagcaggcg
attgctccaaagccttga

DBGET integrated database retrieval system