KEGG   Pseudomonas fulva: Psefu_2056Help
Entry
Psefu_2056        CDS       T01501                                 

Definition
(GenBank) GTP cyclohydrolase 1
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
pfv  Pseudomonas fulva
Pathway
pfv00790  Folate biosynthesis
pfv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Psefu_2056
Enzymes [BR:pfv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Psefu_2056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI
Motif
Other DBs
NCBI-ProteinID: AEF22027
JGI: Psefu_2056
UniProt: F6A9V5
Position
complement(2196246..2196809)
Genome map
AA seq 187 aa AA seqDB search
MDSSRNTLEQHYTAILGQLGEDVSREGLLDTPKRAAKAMQYLCNGYQKTLEEVTNGALFS
SDASEMVVVKDIELYSLCEHHLLPFIGKAHVAYIPNGKVLGLSKVARIVDMYARRLQIQE
SLSRQIAEAVQQVTGALGVAVVIEAKHMCMMMRGVEKQNSSMVTSVMLGEFRENAATRSE
FLSLVSG
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atggactctagccgcaacaccctcgaacagcactacaccgccatcctcggccaactcggc
gaagacgtttcccgggaaggcctgctcgacacgcccaagcgcgccgccaaggccatgcag
tacctgtgcaatggctatcagaaaacgctggaagaagtcaccaacggtgcgctgttcagc
tccgacgccagcgaaatggtggtggtcaaggatatcgagctgtattcgctgtgcgagcac
cacctgctgccctttatcggcaaggcccacgtcgcctacattcccaacggcaaggtgctg
ggcctgtccaaggtggcgcgcatcgtcgacatgtatgcccgccgcctgcagatccaggaa
agcctgagccggcagatcgccgaggccgtccagcaggtcaccggcgccttgggcgtggcg
gtggtcatcgaggccaagcacatgtgcatgatgatgcgcggcgtggagaagcagaactcc
tccatggtcacctcggtgatgctcggtgaattccgcgaaaatgcggcgacccgtagcgag
tttttgagtttggttagcggctga

DBGET integrated database retrieval system