KEGG   Pseudomonas fulva: Psefu_2083Help
Entry
Psefu_2083        CDS       T01501                                 

Definition
ARD/ARD' family protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
pfv  Pseudomonas fulva
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfv00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Psefu_2083
Enzymes [BR:pfv01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     Psefu_2083
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     Psefu_2083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2229550..2230095
Genome map
AA seq 181 aa AA seqDB search
MSRLSVHHQSSPQVPNKVLGHAEDIASTLAAVGIEFRELPLESRVQAGASEQEILAALGE
TLEQLKRDSDLSQAEVISIDQRHWPREGDKPVQAPVEVLADGAQLYLFLAGQGLLSLHVD
DYVYALVGERNALISVPAGTRHWFDLGEFPHCAAIRLSAASAVAVRPSGDAIAASFPRLE
G
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgcctgagcgttcaccatcagtccagcccgcaggttcccaacaaggtgctgggc
cacgccgaagacatcgccagcaccctggcggcggtcggtatcgagtttcgcgaattgccg
ctggaaagccgggtgcaggcgggcgcgagcgagcaggaaattctggcggcgctgggcgag
accctggagcagctcaagcgtgacagcgacctgagccaggccgaggtgatcagcatcgac
cagcgccactggcctcgcgagggcgacaaaccggttcaggcgccggtcgaggtgctggcc
gacggcgcgcagctgtacctgttcctggccggacagggcctgctgagcctgcatgtcgat
gactacgtgtatgccctggtcggtgagcgcaatgcgctgatcagcgtgccggccggcacg
cgtcactggttcgacctgggcgagtttccccattgcgcggcgattcgtctgtctgccgcc
agcgccgtggcggtgcggccaagcggcgatgccatcgctgcgagctttccgcgcctcgaa
ggctag

DBGET integrated database retrieval system