KEGG   Pseudomonas fulva: Psefu_2263Help
Entry
Psefu_2263        CDS       T01501                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
pfv  Pseudomonas fulva
Pathway
pfv00071  Fatty acid degradation
pfv00280  Valine, leucine and isoleucine degradation
pfv00281  Geraniol degradation
pfv00310  Lysine degradation
pfv00360  Phenylalanine metabolism
pfv00362  Benzoate degradation
pfv00380  Tryptophan metabolism
pfv00410  beta-Alanine metabolism
pfv00627  Aminobenzoate degradation
pfv00640  Propanoate metabolism
pfv00650  Butanoate metabolism
pfv00903  Limonene and pinene degradation
pfv00930  Caprolactam degradation
pfv01100  Metabolic pathways
pfv01110  Biosynthesis of secondary metabolites
pfv01120  Microbial metabolism in diverse environments
pfv01130  Biosynthesis of antibiotics
pfv01212  Fatty acid metabolism
Module
pfv_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pfv00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Psefu_2263
   00650 Butanoate metabolism
    Psefu_2263
  Lipid metabolism
   00071 Fatty acid degradation
    Psefu_2263
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Psefu_2263
   00310 Lysine degradation
    Psefu_2263
   00360 Phenylalanine metabolism
    Psefu_2263
   00380 Tryptophan metabolism
    Psefu_2263
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Psefu_2263
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Psefu_2263
   00281 Geraniol degradation
    Psefu_2263
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Psefu_2263
   00627 Aminobenzoate degradation
    Psefu_2263
   00930 Caprolactam degradation
    Psefu_2263
Enzymes [BR:pfv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Psefu_2263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEF22230
JGI: Psefu_2263
UniProt: F6AC48
Position
2429672..2430484
Genome map
AA seq 270 aa AA seqDB search
MGQYQAFRVELQEKIAHVVIDRPDKINAMNAAFWTEIIDIFRWADETDEVRVVVLSGAGK
HFSSGIDLNLLAQVSSQLGKDVGRNALTLRRKILELQASFNAVDQCSKPVLAAIQGYCLG
GAIDLVSACDMRYCSLDVQFAIKEIDIGMAADVGTLQRLPRLIGDGMLRELAYTGRTIEA
AEAREIGLVNRVFETHDTLLSGVMDIARSIAAKSPVAVRGTKAMIGYMRDHRVDDGLDYV
ATWNAAMLQSADLRVAMMAHMSKQNPEFAD
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggggcaataccaggctttccgcgtcgaactgcaggaaaagatcgctcatgtggtgatt
gaccgcccggacaagatcaatgcgatgaacgccgccttctggacggagatcatcgatatc
ttccgttgggccgatgaaaccgacgaagttcgcgtggtggtgctgtctggcgccggcaag
catttctcctccggcatcgacctcaacctgctggctcaggtcagcagccagctcggcaag
gacgtcggccgcaatgccctgaccttgcgccgcaagattctcgagctgcaggcctcgttc
aatgccgtcgaccagtgcagcaaaccggtactggccgccatccagggttactgcctcggt
ggtgccatcgacctggtcagcgcctgcgacatgcgctattgcagcctggacgtgcagttc
gccatcaaggaaatcgacattggcatggccgccgacgtcggcacccttcagcggctgccg
cgcctgatcggcgacggcatgctacgcgagctggcctataccggccgcaccatcgaggct
gccgaggcgcgggaaatcggcctggtcaaccgcgtattcgagacccacgacacattgctg
agcggtgtgatggacatcgcccgcagcatcgccgcaaaatcgccggttgccgtgcgcggt
accaaggcgatgatcggctacatgcgcgatcaccgggtcgacgatggtctcgactacgtc
gccacctggaacgccgccatgctgcaatcggccgatctgcgtgtcgcgatgatggcccat
atgagcaagcaaaaccccgagttcgctgattga

DBGET integrated database retrieval system