KEGG   Pseudomonas fulva: Psefu_2413Help
Entry
Psefu_2413        CDS       T01501                                 

Definition
(RefSeq) D-cysteine desulfhydrase pyridoxal phosphate-dependent protein (EC:4.4.1.15)
  KO
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
pfv  Pseudomonas fulva
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:pfv00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Psefu_2413
Enzymes [BR:pfv01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     Psefu_2413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2598348..2599346
Genome map
AA seq 332 aa AA seqDB search
MISEALNRFERLELVPHATPLQHLLRLSHHVGRDIYVKRDDLTLFALGGNKARKLEYLGC
DALAQHADTLITAGAIQSNHVRQTAALAAKMGLACVALLENPIDTQEQNYLHNGNRLLLD
LFGTRVEHVDNLEEPDLLLMAKADRLRATGKTPYVIPIGGSNALGTLGYVKAGLEFAEQV
TAKGLDSGTLVLASGSGATHAGLALALAHVLPEWRVLGITVSRPADLQRPKVMGLVQRTA
ELLGVNVPENLDIELWDDYYGPRYGEPNTGTLDAIRLLASSQGLLLDPVYTGKAFAGLLD
GVQKGAFEEGKPIVFLHTGGAPALFAYQSLTL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgatcagcgaagccctgaaccgtttcgagcgtctggaactggttccccatgccaccccg
ctgcaacacctgctgcgcctgtcgcatcatgtgggccgcgatatctatgtcaaacgtgat
gacctgaccctgttcgccctgggcggcaacaaggcgcgcaagctcgaatacctgggctgc
gacgccctggcccagcacgccgatacgctgatcaccgccggcgccatccagtccaaccac
gtacgccagactgcggcgctggccgccaagatgggtctggcctgcgttgccttgctggaa
aaccccatcgatacccaggagcagaactacctgcacaacggcaatcgcctcttgctggat
ctgttcggcacccgcgtcgagcacgtcgataacctcgaggagcccgacctgctgctgatg
gccaaggctgatcgcctgcgcgccaccggcaagaccccgtacgtgattccgattggcggc
tccaatgccctgggcaccctgggatacgtaaaagccgggctggaattcgccgagcaggtc
accgccaaaggcctcgacagcggcaccttggtgctggcgtctggcagcggcgccacccac
gcgggcctggcgctggcactcgcccatgtattgcccgaatggcgggtgctcggcatcact
gtgtcgcggcccgccgacttgcagcgcccaaaggtcatgggcctggtgcagcgtacggcc
gaactgttgggcgtgaacgtgccggaaaatctcgatatagaactgtgggacgactattac
ggcccacgctacggcgagccgaataccggaactctggacgccatccgcctgctggccagc
agccagggtctgctgctcgatccggtgtataccggtaaggcgttcgccggcctgctcgat
ggcgtgcaaaaaggcgcgttcgaggaaggcaagccgatcgtcttcctgcacaccggcggt
gcgccggcgctgtttgcgtatcagtccttgactctctaa

DBGET integrated database retrieval system