KEGG   Pseudomonas fulva: Psefu_2420Help
Entry
Psefu_2420        CDS       T01501                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pfv  Pseudomonas fulva
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pfv00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Psefu_2420
   00052 Galactose metabolism
    Psefu_2420
   00500 Starch and sucrose metabolism
    Psefu_2420
   00520 Amino sugar and nucleotide sugar metabolism
    Psefu_2420
Enzymes [BR:pfv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Psefu_2420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2604317..2605153)
Genome map
AA seq 278 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKAMPKEMLPIVNKPLIQYGVEEALSAGLTEIAMVTGRGKR
SLEDHFDISYELEEQIRNTDKEKYLVGIRRLIDNCTFSYTRQVEMKGLGHAILSGRPLIG
DEPFAVVLADDLCLNLEGDSVLSQMVKLYNQFRCSIVAVQEVPMDEIHKYGVIAGEMIRD
DIFRVNSMVEKPKAEDAPSNLAIIGRYILTPDIFELIEKTEPGKGGEIQITDALMKQAQD
GCVLAYKFKGQRFDCGGAEGYIEATNFCFENLYKTGKG
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagaaatgcttgtttcctgccgctggctacggcactcgttttctcccggcaacc
aaggccatgcccaaggaaatgctgccaatcgtgaacaagccgttgatccagtacggtgtc
gaggaagcgctgtctgccggccttaccgaaatcgccatggtgaccggtcgcggcaagcgt
tcgctggaagaccacttcgacatcagttacgagctggaagagcagatccgcaacaccgac
aaggaaaagtacctggtcggtatccgtcgcctgatcgacaactgcactttctcctacacc
cgccaggtggaaatgaagggtctgggccacgccattctcagtggtcgcccgctgatcggt
gacgagccgttcgccgtggtactggccgacgacctgtgcctgaacctggaaggcgacagc
gtgctgagccagatggtcaagctgtacaaccagttccgctgctcgatcgtggcggtgcag
gaagtaccgatggacgagattcacaagtacggcgtgatcgctggcgagatgatccgtgac
gacatcttccgcgtgaacagcatggtcgagaaaccgaaggccgaagacgcaccgtccaac
ctggcgatcatcggtcgctacatcctgaccccggacatcttcgagctgatcgagaaaacc
gagccgggcaagggcggcgagatccagatcaccgacgcgctgatgaagcaggcgcaggac
ggttgcgtgctggcgtacaagttcaagggccagcgtttcgactgcggtggtgccgagggt
tatatcgaagcgaccaacttctgcttcgagaacctgtacaagaccggcaagggctaa

DBGET integrated database retrieval system