KEGG   Pseudomonas fulva: Psefu_2420Help
Entry
Psefu_2420        CDS       T01501                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pfv  Pseudomonas fulva
Pathway
pfv00040  Pentose and glucuronate interconversions
pfv00052  Galactose metabolism
pfv00500  Starch and sucrose metabolism
pfv00520  Amino sugar and nucleotide sugar metabolism
pfv01100  Metabolic pathways
pfv01130  Biosynthesis of antibiotics
Module
pfv_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pfv00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Psefu_2420
   00052 Galactose metabolism
    Psefu_2420
   00500 Starch and sucrose metabolism
    Psefu_2420
   00520 Amino sugar and nucleotide sugar metabolism
    Psefu_2420
Enzymes [BR:pfv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Psefu_2420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AEF22386
JGI: Psefu_2420
UniProt: F6ADU5
Position
complement(2604317..2605153)
Genome map
AA seq 278 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKAMPKEMLPIVNKPLIQYGVEEALSAGLTEIAMVTGRGKR
SLEDHFDISYELEEQIRNTDKEKYLVGIRRLIDNCTFSYTRQVEMKGLGHAILSGRPLIG
DEPFAVVLADDLCLNLEGDSVLSQMVKLYNQFRCSIVAVQEVPMDEIHKYGVIAGEMIRD
DIFRVNSMVEKPKAEDAPSNLAIIGRYILTPDIFELIEKTEPGKGGEIQITDALMKQAQD
GCVLAYKFKGQRFDCGGAEGYIEATNFCFENLYKTGKG
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagaaatgcttgtttcctgccgctggctacggcactcgttttctcccggcaacc
aaggccatgcccaaggaaatgctgccaatcgtgaacaagccgttgatccagtacggtgtc
gaggaagcgctgtctgccggccttaccgaaatcgccatggtgaccggtcgcggcaagcgt
tcgctggaagaccacttcgacatcagttacgagctggaagagcagatccgcaacaccgac
aaggaaaagtacctggtcggtatccgtcgcctgatcgacaactgcactttctcctacacc
cgccaggtggaaatgaagggtctgggccacgccattctcagtggtcgcccgctgatcggt
gacgagccgttcgccgtggtactggccgacgacctgtgcctgaacctggaaggcgacagc
gtgctgagccagatggtcaagctgtacaaccagttccgctgctcgatcgtggcggtgcag
gaagtaccgatggacgagattcacaagtacggcgtgatcgctggcgagatgatccgtgac
gacatcttccgcgtgaacagcatggtcgagaaaccgaaggccgaagacgcaccgtccaac
ctggcgatcatcggtcgctacatcctgaccccggacatcttcgagctgatcgagaaaacc
gagccgggcaagggcggcgagatccagatcaccgacgcgctgatgaagcaggcgcaggac
ggttgcgtgctggcgtacaagttcaagggccagcgtttcgactgcggtggtgccgagggt
tatatcgaagcgaccaacttctgcttcgagaacctgtacaagaccggcaagggctaa

DBGET integrated database retrieval system