KEGG   Pseudomonas fulva: Psefu_2492Help
Entry
Psefu_2492        CDS       T01501                                 

Definition
2-oxoglutarate dehydrogenase E2 (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pfv  Pseudomonas fulva
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pfv01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:pfv00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:pfv00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2679743..2680966)
Genome map
AA seq 407 aa AA seqDB search
MAIEIKAPTFPESVADGTVATWHKKPGEAVKRDELIVDIETDKVVIEVLAEADGVVAEII
KNEGDTVLSNEVLGKLTEGGAAAAAPAAAPAQAAAPAQAAAAPAAAGDDQILSPAARKLA
EENGIDPNSISGSGKGGRVTKEDVVAAVEAKKNAPAAKPAAAAAAAPVVAAAGDRTEKRV
PMTRVRATVARRLVEAQSNMAMLTTFNEVDMSEIMALRSKYKDQFEKAHNGTRLGFMSFF
VKAATEALKRLPAVNASIDGNDIVYHGYQDIGVAVSSDRGLVVPVLRNAELMGLADIEAG
IAAFGKKARDGKLSIEEMTGGTFTITNGGTFGSMMSTPIVNPPQAAILGMHNIIQRPVAV
NGQVVIRPMMYLALSYDHRLIDGKEAVTFLVTIKNLLEDPARLLLDI
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgagatcaaagcccctacattccccgaatcggtcgccgacggcaccgttgct
acctggcacaagaagccgggcgaagcggtcaagcgcgatgagctgatcgtcgacatcgaa
accgacaaggtggtgatcgaagttctggccgaggccgatggcgtggttgccgagatcatc
aagaacgaaggcgataccgtcctctccaacgaagtgctgggcaagctgaccgaaggtggc
gctgctgctgccgctccagccgctgctcctgctcaggctgccgctccggcgcaagccgcc
gctgcacctgccgctgctggcgacgaccagatcctgtcgccggccgctcgcaagctggct
gaagagaacggcatcgatccgaacagcatcagcggttcgggcaaaggtggccgcgtgacc
aaggaagacgtggtcgctgccgtcgaagccaagaaaaacgccccggctgccaaaccggct
gctgccgctgccgccgctcctgtggttgccgcagctggtgatcgcaccgagaagcgcgtg
ccgatgacccgcgttcgcgccactgttgcccgtcgtctggtcgaagcccagtcgaacatg
gcgatgctgaccaccttcaacgaagtcgacatgtccgagatcatggcgctgcgttcgaag
tacaaggaccaattcgagaaggcccacaacggcactcgcctgggcttcatgtccttcttc
gtcaaggccgccaccgaagcgctgaagcgcctgccggcggtcaacgcctcgatcgatggc
aacgacatcgtctaccacggctaccaggacatcggcgtagccgtttccagcgaccgtggc
ctggtggttccggtactgcgcaacgctgagctgatgggcctggccgacatcgaagccggc
atcgccgccttcggcaagaaagcccgtgacggcaagctgtccatcgaagagatgactggc
ggcaccttcaccatcaccaacggtggtaccttcggttcgatgatgtcgacgccgatcgtc
aacccgccgcaggccgcgatcctgggcatgcacaacatcattcagcgcccggttgccgtg
aatggccaggtggtcattcgcccgatgatgtacctggcgctgtcctacgatcaccgcctg
atcgatggtaaagaagccgtgaccttcctggtgaccatcaagaacctgctggaagacccg
gcacgtctgctgctggacatctaa

DBGET integrated database retrieval system