KEGG   Pseudomonas fulva: Psefu_2492Help
Entry
Psefu_2492        CDS       T01501                                 

Definition
2-oxoglutarate dehydrogenase E2 (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pfv  Pseudomonas fulva
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pfv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Psefu_2492
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Psefu_2492
  Amino acid metabolism
   00310 Lysine degradation
    Psefu_2492
Enzymes [BR:pfv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Psefu_2492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2679743..2680966)
Genome map
AA seq 407 aa AA seqDB search
MAIEIKAPTFPESVADGTVATWHKKPGEAVKRDELIVDIETDKVVIEVLAEADGVVAEII
KNEGDTVLSNEVLGKLTEGGAAAAAPAAAPAQAAAPAQAAAAPAAAGDDQILSPAARKLA
EENGIDPNSISGSGKGGRVTKEDVVAAVEAKKNAPAAKPAAAAAAAPVVAAAGDRTEKRV
PMTRVRATVARRLVEAQSNMAMLTTFNEVDMSEIMALRSKYKDQFEKAHNGTRLGFMSFF
VKAATEALKRLPAVNASIDGNDIVYHGYQDIGVAVSSDRGLVVPVLRNAELMGLADIEAG
IAAFGKKARDGKLSIEEMTGGTFTITNGGTFGSMMSTPIVNPPQAAILGMHNIIQRPVAV
NGQVVIRPMMYLALSYDHRLIDGKEAVTFLVTIKNLLEDPARLLLDI
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgagatcaaagcccctacattccccgaatcggtcgccgacggcaccgttgct
acctggcacaagaagccgggcgaagcggtcaagcgcgatgagctgatcgtcgacatcgaa
accgacaaggtggtgatcgaagttctggccgaggccgatggcgtggttgccgagatcatc
aagaacgaaggcgataccgtcctctccaacgaagtgctgggcaagctgaccgaaggtggc
gctgctgctgccgctccagccgctgctcctgctcaggctgccgctccggcgcaagccgcc
gctgcacctgccgctgctggcgacgaccagatcctgtcgccggccgctcgcaagctggct
gaagagaacggcatcgatccgaacagcatcagcggttcgggcaaaggtggccgcgtgacc
aaggaagacgtggtcgctgccgtcgaagccaagaaaaacgccccggctgccaaaccggct
gctgccgctgccgccgctcctgtggttgccgcagctggtgatcgcaccgagaagcgcgtg
ccgatgacccgcgttcgcgccactgttgcccgtcgtctggtcgaagcccagtcgaacatg
gcgatgctgaccaccttcaacgaagtcgacatgtccgagatcatggcgctgcgttcgaag
tacaaggaccaattcgagaaggcccacaacggcactcgcctgggcttcatgtccttcttc
gtcaaggccgccaccgaagcgctgaagcgcctgccggcggtcaacgcctcgatcgatggc
aacgacatcgtctaccacggctaccaggacatcggcgtagccgtttccagcgaccgtggc
ctggtggttccggtactgcgcaacgctgagctgatgggcctggccgacatcgaagccggc
atcgccgccttcggcaagaaagcccgtgacggcaagctgtccatcgaagagatgactggc
ggcaccttcaccatcaccaacggtggtaccttcggttcgatgatgtcgacgccgatcgtc
aacccgccgcaggccgcgatcctgggcatgcacaacatcattcagcgcccggttgccgtg
aatggccaggtggtcattcgcccgatgatgtacctggcgctgtcctacgatcaccgcctg
atcgatggtaaagaagccgtgaccttcctggtgaccatcaagaacctgctggaagacccg
gcacgtctgctgctggacatctaa

DBGET integrated database retrieval system