KEGG   Pseudomonas fulva: Psefu_2496Help
Entry
Psefu_2496        CDS       T01501                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
pfv  Pseudomonas fulva
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pfv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Psefu_2496
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Psefu_2496
   00650 Butanoate metabolism
    Psefu_2496
  Energy metabolism
   00190 Oxidative phosphorylation
    Psefu_2496
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2686622..2686990)
Genome map
AA seq 122 aa AA seqDB search
MVTNVTNFSRSGLYDWMAQRVSAVVLAAYVLFLLGYVVLNPGMGYAQWHGLFSNNAMRIF
SLLTLVALGVHAWVGMWTISTDYLTQTALGKWATVVRFLFQAACGIAMFVFFVWGVQILW
GF
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggtaactaatgtcacgaatttctcgcgttcgggcctctatgactggatggctcagcgt
gtttctgcagtcgtgctcgcggcttatgtcctgttcctgctgggctatgtcgttctgaat
ccgggcatgggctacgcccagtggcacggcctgttctccaataatgcaatgcgcatcttc
agtctgttgaccctcgtcgcgctgggcgtccacgcctgggtcggcatgtggaccatctcc
accgactacctgacgcaaaccgcgctgggcaagtgggcaaccgttgtgcgttttctgttc
caggccgcgtgtggcatcgccatgttcgtgttcttcgtctggggcgtgcagattctttgg
ggtttctga

DBGET integrated database retrieval system