KEGG   Pseudomonas fulva: Psefu_2642Help
Entry
Psefu_2642        CDS       T01501                                 

Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pfv  Pseudomonas fulva
Pathway
pfv00010  Glycolysis / Gluconeogenesis
pfv00620  Pyruvate metabolism
pfv00640  Propanoate metabolism
pfv00680  Methane metabolism
pfv01100  Metabolic pathways
pfv01110  Biosynthesis of secondary metabolites
pfv01120  Microbial metabolism in diverse environments
pfv01130  Biosynthesis of antibiotics
pfv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pfv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psefu_2642
   00620 Pyruvate metabolism
    Psefu_2642
   00640 Propanoate metabolism
    Psefu_2642
  Energy metabolism
   00680 Methane metabolism
    Psefu_2642
Enzymes [BR:pfv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Psefu_2642
Lipid biosynthesis proteins [BR:pfv01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Psefu_2642
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AEF22607
JGI: Psefu_2642
UniProt: F6AGB4
Position
complement(2848675..2850636)
Genome map
AA seq 653 aa AA seqDB search
MSAASLYPVRPEVAANTLTDEATYKAMYQQSVVNPDGFWREQAKRLDWIKPFTKVKQTSF
DDHHVDIKWFADGTLNVSYNCLDRHLEERGDQVAIIWEGDDPSEHKEITYRQLHEQVCKF
ANALRGQDVHRGDVVTIYMPMIPEAVVAMLACARIGAIHSVVFGGFSPEALAGRIIDCQS
KVVITADEGLRGGKKIPLKANVDDALTNPETRSIQKVIVVQRTGSEIKWNQHRDIWFEDL
MKVAGSVCAPKEMGAEEALFILYTSGSTGKPKGVLHTTGGYLLYAALTHERVFDYKPGDV
YWCTADVGWVTGHSYIVYGPLANGATTLLFEGIPNYPDVTRVSKVIDKHKVNILYTAPTA
IRAMMAQGEAAVAGADGSSLRLLGSVGEPINPEAWDWYYRNVGKERCPIVDTWWQTETGG
ILISPLPGATALKPGSATRPFFGVVPALVDNLGNILEGATEGNLVILDSWPGQSRSLYGD
HDRFVDTYFKTFKGMYFTGDGARRDEDGYWWITGRVDDVLNVSGHRMGTAEVESAMVAHP
KVAEAAVVGVPHDIKGQGIYVYVTLNQGEESSEQLRQELKAWVRKEIGPIATPDVIQWAP
GLPKTRSGKIMRRILRKIATSEYDSLGDISTLADPGVVQHLIDTHKSMQSACA
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctgcgtccctgtatcccgtgcgccccgaggtggcggccaatacgctgactgac
gaggccacctacaaggccatgtaccagcagtcggtagtcaaccccgacggtttctggcgc
gagcaggccaagcgcctcgactggatcaagcccttcaccaaggtcaagcagacctccttc
gacgatcaccacgtcgatatcaagtggttcgccgacggcaccctcaacgtctcctacaac
tgcctggaccgtcacctggaagagcgcggcgatcaggtggcgatcatctgggaaggcgat
gacccgtccgagcacaaggaaatcacctaccgccagctgcacgagcaggtgtgcaagttc
gccaacgccctgcgtggccaggacgtgcaccgcggcgacgtggtgaccatctacatgccg
atgattcctgaagccgtggtcgccatgctggcctgcgcgcgcatcggcgccatccactcc
gtggtattcggcggcttctcgccggaagccctggccgggcgcatcatcgactgccagtcc
aaggtggtgatcactgcggacgaaggcctgcgcggcggcaagaagatcccgctcaaggcc
aacgtcgacgacgccctgaccaaccccgaaacgcgcagcatccagaaggtcatcgtggtg
cagcgcaccggttccgagatcaagtggaaccagcaccgcgacatctggttcgaggacctg
atgaaagtggccggcagcgtttgcgcgccgaaggagatgggcgccgaggaagcgctgttc
atcctctacacctccggctctaccggcaaacccaagggcgtgctgcacaccactggcggc
tacctgctttatgcggcgctgacccatgagcgggtgttcgactacaagccgggcgacgtt
tactggtgcaccgccgacgtgggctgggtcaccggccacagctacattgtctacggcccg
ctggccaacggcgcgaccacgctgctgttcgaaggcatccccaattacccggacgtgacc
cgcgtgtcgaaggtcatcgacaagcacaaggtcaatattctctataccgcaccgactgcg
attcgcgccatgatggcccagggcgaagcggctgtggccggtgccgacggttccagcctg
cgtctgctcggttcggtcggtgagccgatcaacccggaagcctgggactggtactaccgc
aacgtcggcaaggagcgttgcccgatcgtcgacacctggtggcagaccgaaaccggcggc
atcctgatcagcccgctgccgggcgccacggcgctcaaaccgggttcggcgacccgtccg
ttcttcggcgtggtgccggcgctggtcgataacctgggcaacattctcgagggggcgacc
gaaggcaacctggtgatcctcgattcctggccgggccagtcgcgcagcctgtatggcgac
cacgaccgcttcgtcgacacctactttaagaccttcaagggcatgtacttcaccggtgac
ggcgcgcgccgcgacgaagatggctactggtggatcaccggccgcgtcgatgacgtgctc
aacgtctccggccaccgcatgggcacggccgaggtggagagcgccatggtcgctcacccg
aaagtcgccgaagctgccgtggttggcgtaccgcacgatatcaaggggcagggtatctac
gtctacgtgacgctcaaccagggcgaggagtcgtccgagcagttgcgccaggaactcaag
gcctgggtgcgcaaggaaatcgggccgatcgccacgccggatgtgatccagtgggcgccg
ggcttgccgaagacccgctcgggcaagatcatgcgccgcatcctgcgcaagatcgccacg
tccgagtacgacagcctcggcgacatctccaccctggccgacccaggcgtggtgcagcac
ctgatcgacacccacaagtcgatgcagagcgcctgcgcctga

DBGET integrated database retrieval system