KEGG   Pseudomonas fulva: Psefu_2691Help
Entry
Psefu_2691        CDS       T01501                                 

Definition
peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pfv  Pseudomonas fulva
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pfv00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Psefu_2691
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Psefu_2691
Enzymes [BR:pfv01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Psefu_2691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2904186..2904674)
Genome map
AA seq 162 aa AA seqDB search
MSQDLLTIPCTTITGEQKCLADFDAKAILVVNTASQCGYTPQYQGLETLWKQYRDKGLVV
LGFPCNQFGKQEPGDEQAIASFCELNFGVSFPLFRKVEVNGSGAHPLFVELKRRAPGLLG
TQGIKWNFTKFLISGDGRQVTRFATATKPHALQAAIEALIDG
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgagccaggatctgctgaccattccctgcaccaccatcaccggcgagcagaagtgcctg
gccgacttcgacgccaaggccattctggtggtcaataccgccagccagtgtggctacacg
ccgcagtatcaagggctggaaacgctgtggaagcagtaccgtgacaaggggctggtggtg
ctgggctttccctgcaaccagttcggcaagcaggagccgggtgacgagcaagccatcgcc
agtttctgcgagctgaatttcggcgtgagctttccgctgtttcgcaaggtggaggtcaat
ggctcgggcgcccatccgctgttcgtggaactcaagcgccgcgcgccgggtttgctcggc
acccagggcatcaagtggaacttcaccaagttcctgatcagcggcgatggccgtcaggtc
acgcgctttgccacggccaccaagccgcacgcgctgcaggcggccatcgaagcgctcatc
gatggatga

DBGET integrated database retrieval system