KEGG   Pseudomonas fulva: Psefu_2791Help
Entry
Psefu_2791        CDS       T01501                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pfv  Pseudomonas fulva
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Psefu_2791
Enzymes [BR:pfv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Psefu_2791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3007091..3009169
Genome map
AA seq 692 aa AA seqDB search
MSDARLAELSKAAGLSVDWIDADGNAQSVKPEHQRRLLDALGYPAADDEQIEASLAQLKQ
REDNLALGPLVTLDQQQALDLTRYFPPGTPFEIQLEQGERLEGRLDDSGRLPVIGTTGYH
QLRIAGGEVTLAVAPAACPSVAELAGRSGAKIWGLSAQLYSLRRPGDGGLGDTQALEALV
RSAAARGADAVAISPMHAMFSANLHTYSPYSPSSRLFFNVLHAAPASVLGEAAVQQAIRT
CGLGEELARLEGLELIDWPGVASARMQILRQLHADFAASIHPLQADFEAFRQAGGDALRQ
HCRFEALRGFMDLNGLPVDWRAWPEQYRDPASPAVEQFCAGHQHEIEFHTFAQWLVARCL
QGAQAAAREAGMAVGLIADLAVGADAAGSQAWGRQAELLQSVSVGAPPDILNRSGQNWGV
SAFSPQGLQENGFRAYIEMLRANLAHAGGMRIDHVMTMRRLWVIPAGEDSSAGAYLNYPF
QDLLRLLCLEAERHRALIIGEDLGTVPDGLREELAARNILGMRVLLFEQSNGHFHAPAHW
PRDALATTTTHDLPSIRGWLASRDIHWRQAAGHRSDDYTNQDHHLRAQETRALHQALHEH
GHATADQMDDGQQLDASIAFIGSTPAPLVLLPLEDAMAAMEQPNLPGPGDEHPNWRRRWA
ENADSMLDAPAVAHRLQRLQWARNLAEGLGHD
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatgcacgcctggcagaactgagcaaggccgcgggcctgagcgtcgactggatc
gacgccgacggcaacgcccaatcggtcaaacccgaacaccagcgtcgcctgctcgatgcc
cttggctatcccgccgcggatgacgagcagatcgaagccagcctggcgcagctgaagcaa
cgcgaagacaacctggccctcggcccgctggtgaccctcgaccagcagcaggctctggac
ctgacccgttatttcccgccgggtacacccttcgagattcagctcgaacagggcgaacgc
ctggaaggccggctggatgatagcggccgcctgccggtgatcggcaccaccggctatcac
caattgcgcatcgctggcggcgaagtgaccctggccgtggcgcccgccgcgtgccccagc
gttgccgagctggccggtcgcagcggcgcgaagatctggggcctcagcgcccagctgtat
tcgctgcgccgcccgggtgacggcggcctgggcgatacccaggcgctggaagccttggtg
cgcagcgccgctgcacggggtgcagacgcggtggcgatcagcccgatgcacgccatgttc
agcgccaacctgcacacctacagcccctattcgccgtccagccggctgtttttcaacgtg
ctgcatgctgcaccggccagtgtgctcggagaggcagcggtgcagcaggcgatccgcacc
tgcggtctgggcgaggaactggcgcgcctggaaggcctggagctgatcgactggccgggc
gtcgccagcgcgcgcatgcagatcctgcggcagctgcacgcggactttgccgccagcatc
catccgctgcaggccgacttcgaggcgttccgccaggctggcggcgatgccctgcgccag
cactgccgcttcgaggcgctgcgcggcttcatggacctcaacggcctgccggtcgactgg
cgggcctggcccgagcagtaccgcgaccctgccagcccggcggtggaacagttctgcgca
ggccatcagcacgagatcgaattccacaccttcgcccaatggctggtggcccgttgcctg
caaggcgcgcaggcggcagcccgtgaagcgggcatggcggtcggcctgatcgccgacctg
gccgtcggcgccgatgccgctggcagccaggcctggggccggcaggccgaactgctgcag
tcggtcagcgtcggtgcaccaccggacattctcaatcgctcggggcaaaactggggcgtg
tcggcgttctcaccccagggcctgcaggagaatggctttcgcgcctatatcgaaatgttg
cgcgccaacctggcccacgccggcggcatgcgcatcgaccatgtgatgacgatgcgtcgc
ctttgggtgatccctgcgggcgaggactcgtctgccggcgcctacctcaactatcccttc
caggatctgctgcgcctgctgtgcctggaggccgagcgccaccgcgcgctgatcatcggc
gaggacctgggcacggtgcccgacggcctgcgggaagaactcgcggcacgcaacattctc
ggcatgcgcgtgctgctgttcgagcagagcaatggccacttccacgctccggcccattgg
ccgcgtgacgccctagccaccaccacaacccatgatctgccgagcattcgcggctggctc
gcctcccgcgacatccattggcgccaggctgcgggccaccgcagcgacgactacaccaac
caggatcatcacttgcgcgcccaggaaacccgagcactgcaccaggctctgcacgagcac
ggccacgccaccgccgaccagatggacgacggccaacagctggacgccagcatcgccttc
attggcagcacgccggcgccgctggtgctgctgccgctggaagacgccatggctgccatg
gagcagcccaacctgccaggccccggcgacgaacacccgaactggcgccgccgttgggcc
gaaaatgccgacagcatgctcgacgccccggccgtcgcccatcgcctgcagcgtctgcaa
tgggcgcgcaacctggcggagggcctcggccatgactaa

DBGET integrated database retrieval system