KEGG   Pseudomonas fulva: Psefu_2813Help
Entry
Psefu_2813        CDS       T01501                                 

Definition
1,4-alpha-glucan branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pfv  Pseudomonas fulva
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pfv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Psefu_2813
Enzymes [BR:pfv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Psefu_2813
Exosome [BR:pfv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Psefu_2813
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3029187..3031391)
Genome map
AA seq 734 aa AA seqDB search
MSNGETERQVAGLERAAVEALIRGEHGDPFSILGPHAFAHGLTIRAYLPGALGVELIHAV
TGEVLGTLEQSSVPGLFSIRIEQQVPYRYRIQWGTGVQETEDPYAFGQLLGEMDLYLFAE
GNHRELGKSLGAQFTTHEGVQGVRFSVWAPNARRVSVVGNFNGWDGRRHPMRLRQPSGVW
ELFIPRLAPGEVYKYEILGRDGLLPLKADPMALASELPPATGSVVSAPLQFDWHDDHWLE
QRQARQAYQAPMSIYELHAGSWRREGGENGRLLSWRELSEQLIPYVQQLGFTHIELMPIM
EHPFGGSWGYQLLSQFAPTARYGSPADFAAFVDACHQAGIGVILDWVPAHFPTDAHGLGQ
FDGTALYEYAHPFEGFHQDWDTYIYNLGRTEVHGFMLASALHWLRTYHIDGLRVDAVASM
LYRDYSRKDGEWIPNRFGGRENLESIDFLRHLNDVVAQEVPGALVIAEESTAWPGVSRPT
QEGGLGFAYKWNMGWMHDSLKYAAEDPLHRRHHHHQLTFGLLYAFSEHFVLPISHDEVVH
GKRSLLDKMPGDRWQKFANLRLYLSFMWSHPGKKLLFMGCEFGQWREWNHDHELDWYLLR
YGEHKGVQQLVSDLNGLYRHEPALHQLDGSAEGFAWLIGDDANNSVFAWLRHDQSGAPLL
VVHNFTPEPRNGYRIGVPKEGAWHVLLNSDSERYAGSNAGSQGGLFSEAVASHGQPQSLS
LDLPPLGTLVIKPQ
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatggagaaaccgagcgccaggtggcgggactggaacgtgccgctgtcgaggcc
ctgatccggggcgagcatggcgatccgttttcgattctgggcccccacgcgttcgcccac
gggctgacgattcgtgcctacctgcctggcgcccttggtgtcgagctgatccacgcggta
accggcgaggtgctcggcactctggagcaatccagcgtgccagggctgttcagcatccgc
atcgagcagcaggtgccgtatcgctatcgcatccagtggggaaccggcgtacaggaaacc
gaggacccttacgcctttggtcaactgctcggcgagatggacctgtacctgttcgccgag
ggcaatcaccgtgagctgggcaagagcctgggcgcccagttcactacccatgaaggcgtg
cagggcgtgcgcttttcggtgtgggcgcccaacgcccggcgggtctcggttgtcggtaat
ttcaacggttgggacggccgtcgtcacccgatgcgcctgcgtcagcccagtggtgtgtgg
gagctgttcattccgcgcctggcgcccggcgaagtctacaaatacgagattctcggccgc
gatggtctgttgccgctcaaggccgatcccatggcgctggccagtgagctgccgccggct
accggctcggtggtatccgcgccgctgcagttcgactggcacgatgaccattggctcgag
cagcggcaggctcgccaggcctaccaggcgccgatgtcgatttacgaattgcatgccggt
tcctggcgccgcgagggcggcgagaatggccgcctgctgagctggcgcgagctgagcgaa
cagctgattccctatgtgcagcaactgggcttcacccatatcgagctgatgccgatcatg
gagcacccgttcggcggttcctggggttaccagttgctgtcgcaattcgccccgactgcg
cgttacggcagcccggcggatttcgccgccttcgtcgacgcctgccaccaggccggcatt
ggcgtgatcctcgactgggtgccggcgcatttccccaccgacgcccatggcctcggtcag
ttcgacggcactgcgctgtacgaatacgcccacccgttcgagggtttccaccaggattgg
gacacctacatctacaacctgggccgcaccgaggtgcacggcttcatgctggcctcggcg
ctgcactggctgcgcacctatcatatcgacggcctgcgcgtggacgccgtggcctcgatg
ctctaccgcgactattcgcgcaaggacggcgagtggatccccaaccgtttcggcgggcgc
gagaacctggagagcatcgacttcctgcgccatctcaacgatgtggtcgcccaggaagtg
cccggcgcactggtgatcgccgaggaatcgaccgcctggccgggcgtcagccgaccgacc
caggagggcggcctgggctttgcctacaagtggaacatgggctggatgcacgacagcctc
aaatacgctgccgaggatccgctgcaccgtcgccaccatcaccatcagctgaccttcggc
ctgctgtacgccttctccgagcatttcgtgctgcccatctcccacgacgaagtggtgcac
ggcaagcgctcgctgctcgacaagatgccgggcgaccgctggcagaagttcgccaacctg
cgcctgtacctgagcttcatgtggagccacccgggcaagaagctgctgttcatgggctgc
gagttcggccagtggcgcgagtggaaccacgaccatgaactggactggtatctgctgcgc
tatggcgagcacaagggcgtgcagcaactggtgagcgacctcaacggcctgtaccgccac
gagccggcgctgcaccagctagacggcagcgccgaaggttttgcctggctgatcggtgac
gatgccaacaacagcgtgttcgcctggctgcgtcatgatcagagcggcgcgcccctgctg
gtggtacacaacttcacccccgagccgcgcaacggctaccgcatcggcgtgccgaaggag
ggcgcctggcacgtgctgctcaacagcgactccgaacgttacgccggctccaacgccggc
agtcagggcgggctgttcagcgaggcggtggccagccatggtcagcctcagtccctgagc
ctggatctgccgccgctgggtacgctggtcatcaagccgcaatga

DBGET integrated database retrieval system