KEGG   Pseudomonas fulva: Psefu_2918Help
Entry
Psefu_2918        CDS       T01501                                 

Definition
(GenBank) Fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
pfv  Pseudomonas fulva
Pathway
pfv00071  Fatty acid degradation
pfv00280  Valine, leucine and isoleucine degradation
pfv00281  Geraniol degradation
pfv00310  Lysine degradation
pfv00362  Benzoate degradation
pfv00380  Tryptophan metabolism
pfv00410  beta-Alanine metabolism
pfv00640  Propanoate metabolism
pfv00650  Butanoate metabolism
pfv00903  Limonene and pinene degradation
pfv00930  Caprolactam degradation
pfv01040  Biosynthesis of unsaturated fatty acids
pfv01100  Metabolic pathways
pfv01110  Biosynthesis of secondary metabolites
pfv01120  Microbial metabolism in diverse environments
pfv01130  Biosynthesis of antibiotics
pfv01200  Carbon metabolism
pfv01212  Fatty acid metabolism
Module
pfv_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pfv00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Psefu_2918
   00650 Butanoate metabolism
    Psefu_2918
  Lipid metabolism
   00071 Fatty acid degradation
    Psefu_2918
   01040 Biosynthesis of unsaturated fatty acids
    Psefu_2918
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Psefu_2918
   00310 Lysine degradation
    Psefu_2918
   00380 Tryptophan metabolism
    Psefu_2918
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Psefu_2918
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Psefu_2918
   00281 Geraniol degradation
    Psefu_2918
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Psefu_2918
   00930 Caprolactam degradation
    Psefu_2918
Enzymes [BR:pfv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Psefu_2918
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Psefu_2918
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Psefu_2918
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     Psefu_2918
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AEF22882
JGI: Psefu_2918
UniProt: F6AJL3
Position
complement(3135452..3137599)
Genome map
AA seq 715 aa AA seqDB search
MIYEGKAITVKALESGIVELKFDLKGESVNKFNRLTLSELRQSVDAIKADASIKGVIVSS
GKDVFIVGADITEFVDNFKLPEEQLVSSGLEANKIFSDFEDLNVPTVVAINGIALGGGLE
MCLAADYRVMAEGAKIGLPEVKLGIYPGFGGTVRLPRLIGTDNAVEWIASGKENRAEEAL
KVGAVDAVVAADKLQAAALDLIKRAISGELDYKAKRQPKLEKLKLNAIEQMMAFETAKGF
VAGQAGPNYPAPVEAIKTIQKAANFGRDKALEVEAAGFAKLAKTSVAKSLIGLFLNDQEL
KKKAKAHDAIAKDVKLAAVLGAGIMGGGIAYQSASKGTPILMKDIREEGIKMGLGEASKL
LAKRVEKGRMTTAQMAESLSAIRPTMSYGDFGHVDIVVEAVVENPKVKQAVLAEVEGAVK
EGTILASNTSTISISLLAKALKHPENFVGMHFFNPVHMMPLVEVIRGEKSSDEAVATTVA
YAKKMGKNPIVVNDCPGFLVNRILFPYFGGFATLLSFGVDFARIDKVMEKFGWPMGPAYL
SDVVGIDTGHHGRDVMAEGFPDRMAVDGRTAVDVMYEANRLGQKNGKGFYAYETDKRGKP
KKVSDPEAYELLKSIVKEQRELSDEDIVNIMMIPLCLETVRCLEDGIVETAAEADMGLVY
GIGFPPFRGGALRYIDSVGVAEFVALADKYADLGALYKPTEKLREMAKNGQTFFG
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgatttacgaaggtaaagccatcacggttaaggctcttgaaagcggcattgtcgaactc
aagttcgacctcaagggtgagtccgtcaacaagttcaatcgtctgaccctgagcgagctg
cgccagagcgtcgatgcgatcaaggccgatgcctcgatcaagggcgttatcgtcagcagc
ggcaaggacgtgttcatcgtcggcgccgacatcaccgagttcgtcgacaacttcaagctg
cccgaagagcagctggtttccagcggtctggaagccaacaagatcttcagcgatttcgaa
gacctgaacgtgcccaccgtggtcgccatcaacggcatcgccctgggtggcggtctggaa
atgtgcctggccgccgattaccgggtcatggccgaaggcgccaagatcggcctgccggaa
gtcaaactgggtatctacccaggctttggcggcaccgtgcgtctgccgcgtctgatcggt
accgacaacgcggtcgagtggatcgcctccggcaaggaaaaccgtgccgaggaagctctc
aaggttggcgcggtggacgccgtggttgccgccgacaagctgcaggccgctgccctggac
ctgatcaagcgcgccatttccggcgagctcgactacaaggccaagcgtcagcccaagctc
gagaagctcaagctcaacgccatcgagcagatgatggctttcgaaaccgccaagggtttc
gtggccggccaggcgggcccgaactacccggcgccggtcgaagcgatcaagaccatccag
aaggccgccaacttcggccgtgacaaggcgcttgaagtcgaagccgccggtttcgccaag
ttggccaagacttctgtcgccaagagcctgatcggtctattcctcaacgatcaggagctc
aagaaaaaggccaaggctcacgacgccatcgccaaggacgtgaagctggctgccgtattg
ggcgccggcatcatgggtggcggcatcgcctaccagtcggcttccaagggcacgccgatc
ctgatgaaggatatccgcgaggaaggcatcaagatggggctgggcgaggcgtccaagctg
ctggccaagcgtgtcgagaagggtcgcatgaccaccgcgcagatggccgaatcgctgagc
gccattcgcccgaccatgtcctacggcgacttcggtcacgtcgacatcgtcgtcgaagcc
gtggtcgagaaccccaaggtcaagcaggccgtgctggccgaggtcgagggcgcggtcaag
gagggcaccatcctggcgtccaacacctcgaccatctccatcagcctgttggccaaggcc
ctcaagcacccggaaaacttcgtcggcatgcacttcttcaacccggtgcacatgatgccg
ctggtcgaagtcatccgcggcgagaagtccagtgacgaggcggtggccaccaccgtggcg
tacgccaagaagatgggcaagaacccgatcgtggtcaacgactgtccgggctttctggtc
aaccgcatcctgttcccgtacttcggcggtttcgccacgctgcttagcttcggcgtcgac
ttcgcgcgtatcgacaaggtcatggagaagttcggctggcccatgggccctgcgtacctg
tccgacgtggtcggcatcgacaccggccaccacggccgtgacgtgatggccgaaggcttc
ccggatcgcatggccgtcgacggccgtaccgcggtcgacgtgatgtacgaagccaaccgc
ctgggccagaagaacggcaagggcttctacgcctacgagaccgacaagcgcggcaagccg
aagaaggtcagcgaccccgaggcctacgagttgctcaagtcgatcgtcaaggagcagcgc
gagctgagcgacgaggacatcgtcaacatcatgatgatcccgctgtgcctggaaaccgtg
cgctgcctggaagacggtatcgtcgagaccgccgccgaggccgatatgggcctggtttac
ggcatcggtttcccacccttccgtggtggtgcgctgcgttacatcgacagcgtcggggtt
gccgaattcgtggccctggccgacaagtacgccgatctgggcgcgctgtacaagccgacc
gagaaactgcgtgaaatggccaaaaacggccagaccttcttcggttaa

DBGET integrated database retrieval system