KEGG   Pseudomonas fulva: Psefu_3568Help
Entry
Psefu_3568        CDS       T01501                                 

Definition
phospho-N-acetylmuramoyl-pentapeptide-transferase
Orthology
K01000  
phospho-N-acetylmuramoyl-pentapeptide-transferase [EC:2.7.8.13]
Organism
pfv  Pseudomonas fulva
Pathway
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:pfv00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3840528..3841610)
Genome map
AA seq 360 aa AA seqDB search
MLLLLAEYLQQFYKGFAVFQYLTLRGILGVLTALVLALCLGPWMIRTLQIRQIGQAVRND
GPQSHLSKKGTPTMGGALILSAIAISTLLWADLSNRYVWVVLVVTLLFGAIGWVDDYRKV
IEKNSRGLPSRWKYFWQSVFGIGAAVFLYMTAQSPIETTFIVPLLKDVSIPLGIGFVVLT
YFVIVGSSNAVNLTDGLDGLAILPTVMVGGALGIFCYLSGNVKFAEYLLIPYVPGAGELI
VFCGALIGAGLGFLWFNTYPAQVFMGDVGALALGAALGTIAVIVRQEIVLFIMGGVFVME
TLSVIIQVASFKLTGKRVFRMAPIHHHFELKGWPEPRVIVRFWIITVILVLIGLATLKLR
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgctgctggcagagtatctgcaacagttctacaagggcttcgcggtctttcag
tacctgaccctgcgcgggattctcggcgtgctgactgcgcttgtgctggcgctgtgcctg
gggccgtggatgatccgtaccctgcagatccgccagatcggccaggccgtgcgcaacgac
ggcccccagtcgcacctgtccaagaagggcacgccgaccatgggtggcgcgctgatcctc
tcggccatcgccatcagcaccctgctgtgggctgacctgagcaaccgctatgtatgggtg
gtgctggtcgtcaccctgctgttcggcgccatcggctgggtcgacgactaccgcaaggtg
atcgagaagaactcgcgcggcctgccgagccgctggaagtacttctggcagtcggtgttc
ggcatcggcgcggctgtcttcctttatatgaccgcgcagagcccgatcgaaaccaccttc
atcgtgccgctgctcaaggatgtcagcatcccgctgggcatcggtttcgtggtgctgacc
tacttcgtgatcgtcggctccagcaacgcggtgaacctcaccgacggcctcgacggcctg
gcgattctgcccaccgtgatggtcggcggcgccctgggcatcttctgctacctgtcgggc
aacgtgaaattcgccgaatacctgctgatcccgtacgtgccgggcgcaggcgagctgatc
gtgttctgcggcgcgctgatcggcgccggcctgggctttctgtggttcaacacctacccg
gcgcaggtgttcatgggcgacgtcggcgcgctggcgctgggcgccgcgctgggcaccatc
gctgtgatcgtgcgtcaggaaatcgtgctgttcatcatgggcggcgtattcgtgatggaa
accctgtcggtgatcatccaggtcgccagcttcaagctgaccggcaagcgcgtgttccgc
atggcaccgattcaccaccatttcgagttgaagggttggcccgagccacgggttatcgtt
cgtttctggatcatcaccgtcattctggtgctgatcggcctcgctactttgaaactgcgt
tga

DBGET integrated database retrieval system