KEGG   Pseudomonas fulva: Psefu_3661Help
Entry
Psefu_3661        CDS       T01501                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
pfv  Pseudomonas fulva
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pfv01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:pfv00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3935257..3936567)
Genome map
AA seq 436 aa AA seqDB search
MTAPVAIRRLNAADADFAQHLDHLLSWESVSDDGVNGRVLDIIKAVRERGDAALVEFTQR
FDALDVASMADLILPRERLELALTRITAEQRQALETAADRVRSYHEKQKQDSWTYTEADG
TVLGQKVTPLDRAGLYVPGGKASYPSSVLMNAIPAKVAGVPEVVMVVPTPRGEINEIVLA
AAAIAGVDRVFTIGGAQAVAALAYGTESVPPVDKIVGPGNIYVATAKRHVFGKVGIDMIA
GPSEILVVCDGQTDPDWIAMDLFSQAEHDEDAQAILVSPDAAFLDKVAESIAKLLPSLER
EAIARTSIEGRGALILVEDMTQAIEVANRIAPEHLELSVEDPEQYLPQIRHAGAIFMGRY
TAEALGDYCAGPNHVLPTSGTARFSSPLGVYDFQKRSSIIHCSADGASELGKVASVLARG
ESLTAHARSAEYRIKS
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctccagttgccattcgccgactcaacgctgccgacgcggatttcgcccagcat
ctggatcatctgctgagctgggaaagcgtctccgacgacggcgtcaatgggcgcgtgctg
gacatcatcaaggccgtgcgcgagcgcggtgacgccgcgctggtcgagttcacccagcgt
ttcgatgcgctggatgtcgcctccatggccgacctgattcttccccgcgagcgcctggag
ctggcgctcacccgcatcaccgccgagcagcgccaggcgctggaaacggctgctgaccgc
gtgcgcagctaccacgaaaagcaaaaacaggattcctggacctacaccgaggccgacggc
acggtgctgggtcagaaggtcacgccgctcgaccgtgctggcctgtacgtgccgggcggt
aaggcttcttacccgtcttcggtactgatgaacgccattcccgccaaggtcgccggcgtg
cccgaggtggtcatggtggtgccgacgccgcgtggagagatcaacgagatcgtattggcc
gccgccgccattgccggcgtcgatcgggtgttcaccatcggtggcgcccaggctgtcgcc
gcgctggcctacggcactgagagcgtgccgccggtggacaagatcgtcggcccgggcaac
atctatgtcgccactgccaagcgccatgtattcggcaaggtcggcatcgacatgatcgcc
gggccgtcggaaattctcgtggtgtgcgacggccagaccgacccagactggatcgccatg
gatctgttctcccaggccgagcacgacgaagacgcccaggcgattctggtcagcccggac
gcggcgtttctcgacaaggtagcagagagcatcgccaaactgctgccgagcctggagcgc
gaagccattgcccgtacctccatcgaaggtcgcggtgcgctgattttggtcgaagacatg
acccaggccatcgaagtggccaaccgtatcgcccccgagcaccttgagctgtcggtggag
gacccggagcagtacctgccgcagattcgccatgccggcgcgatcttcatgggccgctac
accgccgaggcgctgggcgactactgcgccggccccaaccacgtgctgccgacctcgggc
actgcgcgcttctcctcgccgctgggtgtgtatgacttccagaagcgttcgtcgatcatc
cactgctcggccgatggtgcttccgaactgggcaaggtggcgtcggtgctcgcccgcggc
gagtcgctgaccgcccacgcccgcagcgccgaataccgcatcaagagctga

DBGET integrated database retrieval system