KEGG   Pseudomonas fulva: Psefu_3855Help
Entry
Psefu_3855        CDS       T01501                                 

Definition
(GenBank) Malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
pfv  Pseudomonas fulva
Pathway
pfv00620  Pyruvate metabolism
pfv00630  Glyoxylate and dicarboxylate metabolism
pfv01100  Metabolic pathways
pfv01110  Biosynthesis of secondary metabolites
pfv01120  Microbial metabolism in diverse environments
pfv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pfv00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Psefu_3855
   00630 Glyoxylate and dicarboxylate metabolism
    Psefu_3855
Enzymes [BR:pfv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Psefu_3855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase DUF3450
Motif
Other DBs
NCBI-ProteinID: AEF23811
JGI: Psefu_3855
UniProt: F6AHA8
Position
4160451..4162628
Genome map
AA seq 725 aa AA seqDB search
MTERVRVGGLQVAKVLFDFINNEAIPGSGVTADAFWSGADAVFRDLAPKNRALLDKRDQL
QAQIDDWHRERAGKPHDAAAYKTFLQQIGYLQPQPEHVQASTENVDDEIARMAGPQLVVP
VMNARFALNASNARWGSLYDALYGTDAISEEGGAEKGKGYNRVRGDKVIAAARAFLDESA
PLATGSHAEATGYRIEGDKLLVTLANGDITGLREAGQLVGFQGEAAAPIAILLKHNGLHF
EIQIDAASPIGSTDAAGVKDVLMESALTTIMDCEDSVAAVDADDKTVIYRNWLGLMKGDL
SEEVSKGGSTFTRTMNPDRVYTRPNGGELTLHGRSLLFVRNVGHLMTNPAVLDASGNELP
EGILDALCTSLAALHNLNGNNSRANSRTGSVYIVKPKMHGAEEVAFTSELFGRVEQVLGL
ARNTLKVGIMDEERRTTVNLKACIAAASERVVFINTGFLDRTGDEIHTSMEAGAMVRKAA
MKSEKWISAYENNNVDVGLASGLQGRAQIGKGMWAMPDLMAAMLEQKIGHPLAGANTAWV
PSPTAATLHALHYHKVDVFARQAELTKRTPASLDEILSIPLAPETNWSAEEIRNELDNNA
QGILGYVVRWIDQGVGCSKVPDINDIGLMEDRATLRISSQLLANWLRHGVVSEAQVLESL
KRMAPVVDRQNAGDALYRPMAPDFDSNIAFQAAVELVLEGAKQPNGYTEPVLHRRRRELK
ASLAR
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcgtgttcgagtcggtggcctgcaggtcgccaaggtgctgttcgatttcatc
aacaacgaagccatccccggcagcggcgtgacggccgatgcgttctggagcggcgccgat
gccgtgttccgtgacctggcgccgaagaaccgcgcgctgctcgacaagcgcgaccagctg
caggcgcagatcgacgactggcaccgcgagcgggccggcaagccccacgacgcggcggcc
tacaaaaccttcctgcagcagatcggctacctgcagccgcagcctgagcacgtgcaggcc
agcaccgagaacgtcgacgacgagatcgcccgcatggccggcccgcaactggtggtgccg
gtgatgaacgcacgcttcgcactcaacgccagcaacgcccgctggggctcgctgtacgac
gcgctgtacggcaccgatgcgatcagcgaagaaggcggcgccgaaaagggcaagggctac
aaccgcgtacgcggtgacaaggtgatcgccgccgcgcgcgccttcctcgatgaaagcgcg
ccgctggccaccggctcccacgccgaggccaccggctaccgcatcgagggcgacaaactg
ctggtcaccctggccaatggcgacatcaccggcctgcgcgaggctggccagctggtcggt
ttccagggcgaggccgctgcgcccatcgccattctgctcaagcacaacggcctgcatttc
gagatccagatcgacgccgcgagcccgatcggcagcaccgacgccgccggcgtgaaggac
gtgctgatggagtcggcgctgaccaccatcatggactgcgaagactcggtggcggcggtc
gatgccgacgacaagaccgttatctaccgcaactggctgggcctgatgaagggcgacctc
agcgaggaagtcagcaagggcggtagcaccttcacccgcaccatgaacccggatcgcgtc
tacacccgcccgaacggcggcgagctcaccctgcacgggcgcagcctgctgttcgtgcgc
aacgtcggccacctgatgaccaacccggcggtactcgacgccagcggcaacgaactgccc
gaaggcattctcgatgcgctgtgcaccagcctcgccgcgctgcacaacctcaacggcaac
aacagccgcgccaacagccgcaccggctcggtgtacatcgtcaaaccgaagatgcatggc
gcggaagaagtcgccttcaccagcgaactgttcggccgtgtcgagcaggtgctgggcctg
gcgcgcaatacgctcaaggtcggcatcatggacgaggagcggcgcaccaccgtcaaccta
aaggcctgcatcgccgcggccagcgagcgcgtggtgttcatcaacaccggtttcctcgac
cgcaccggcgacgagatccacacctccatggaagccggcgccatggtgcgcaaggccgcc
atgaagagcgagaagtggatcagcgcctacgagaacaacaacgtcgacgtcggcctggcc
agcggcctgcagggccgtgcacagatcggcaagggcatgtgggcaatgcccgacctgatg
gccgccatgctcgaacagaagatcggccacccgctggctggcgccaacaccgcctgggtg
ccctcgccgaccgctgccaccctgcacgcactgcactatcacaaggtcgacgtgttcgcc
cgccaggccgagctgaccaagcgaaccccggcttcgctggatgaaatcctcagcattccg
ctggcgccagaaaccaactggagcgccgaggaaatccgcaacgagctggacaacaacgcc
cagggcatcctcggctacgtggtgcgctggatcgaccagggcgtcggctgctccaaggtg
ccggacatcaacgacatcggtctgatggaagaccgcgccaccctgcgcatttccagtcag
ctactggccaactggctgcgccacggcgtggtcagcgaagcgcaggtgctggaaagcctc
aagcgcatggcgccggtagtggaccggcagaatgccggcgatgcgttgtaccgcccgatg
gcgccggacttcgacagcaacatcgccttccaggcggccgtggagctggtactcgaaggt
gccaagcagcccaacggctataccgagccggtgctgcatcgccgtcgtcgtgaactgaag
gccagcctggcgcgctaa

DBGET integrated database retrieval system