KEGG   Pseudomonas fulva: Psefu_3855Help
Entry
Psefu_3855        CDS       T01501                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
pfv  Pseudomonas fulva
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pfv01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pfv00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:pfv00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4160451..4162628
Genome map
AA seq 725 aa AA seqDB search
MTERVRVGGLQVAKVLFDFINNEAIPGSGVTADAFWSGADAVFRDLAPKNRALLDKRDQL
QAQIDDWHRERAGKPHDAAAYKTFLQQIGYLQPQPEHVQASTENVDDEIARMAGPQLVVP
VMNARFALNASNARWGSLYDALYGTDAISEEGGAEKGKGYNRVRGDKVIAAARAFLDESA
PLATGSHAEATGYRIEGDKLLVTLANGDITGLREAGQLVGFQGEAAAPIAILLKHNGLHF
EIQIDAASPIGSTDAAGVKDVLMESALTTIMDCEDSVAAVDADDKTVIYRNWLGLMKGDL
SEEVSKGGSTFTRTMNPDRVYTRPNGGELTLHGRSLLFVRNVGHLMTNPAVLDASGNELP
EGILDALCTSLAALHNLNGNNSRANSRTGSVYIVKPKMHGAEEVAFTSELFGRVEQVLGL
ARNTLKVGIMDEERRTTVNLKACIAAASERVVFINTGFLDRTGDEIHTSMEAGAMVRKAA
MKSEKWISAYENNNVDVGLASGLQGRAQIGKGMWAMPDLMAAMLEQKIGHPLAGANTAWV
PSPTAATLHALHYHKVDVFARQAELTKRTPASLDEILSIPLAPETNWSAEEIRNELDNNA
QGILGYVVRWIDQGVGCSKVPDINDIGLMEDRATLRISSQLLANWLRHGVVSEAQVLESL
KRMAPVVDRQNAGDALYRPMAPDFDSNIAFQAAVELVLEGAKQPNGYTEPVLHRRRRELK
ASLAR
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcgtgttcgagtcggtggcctgcaggtcgccaaggtgctgttcgatttcatc
aacaacgaagccatccccggcagcggcgtgacggccgatgcgttctggagcggcgccgat
gccgtgttccgtgacctggcgccgaagaaccgcgcgctgctcgacaagcgcgaccagctg
caggcgcagatcgacgactggcaccgcgagcgggccggcaagccccacgacgcggcggcc
tacaaaaccttcctgcagcagatcggctacctgcagccgcagcctgagcacgtgcaggcc
agcaccgagaacgtcgacgacgagatcgcccgcatggccggcccgcaactggtggtgccg
gtgatgaacgcacgcttcgcactcaacgccagcaacgcccgctggggctcgctgtacgac
gcgctgtacggcaccgatgcgatcagcgaagaaggcggcgccgaaaagggcaagggctac
aaccgcgtacgcggtgacaaggtgatcgccgccgcgcgcgccttcctcgatgaaagcgcg
ccgctggccaccggctcccacgccgaggccaccggctaccgcatcgagggcgacaaactg
ctggtcaccctggccaatggcgacatcaccggcctgcgcgaggctggccagctggtcggt
ttccagggcgaggccgctgcgcccatcgccattctgctcaagcacaacggcctgcatttc
gagatccagatcgacgccgcgagcccgatcggcagcaccgacgccgccggcgtgaaggac
gtgctgatggagtcggcgctgaccaccatcatggactgcgaagactcggtggcggcggtc
gatgccgacgacaagaccgttatctaccgcaactggctgggcctgatgaagggcgacctc
agcgaggaagtcagcaagggcggtagcaccttcacccgcaccatgaacccggatcgcgtc
tacacccgcccgaacggcggcgagctcaccctgcacgggcgcagcctgctgttcgtgcgc
aacgtcggccacctgatgaccaacccggcggtactcgacgccagcggcaacgaactgccc
gaaggcattctcgatgcgctgtgcaccagcctcgccgcgctgcacaacctcaacggcaac
aacagccgcgccaacagccgcaccggctcggtgtacatcgtcaaaccgaagatgcatggc
gcggaagaagtcgccttcaccagcgaactgttcggccgtgtcgagcaggtgctgggcctg
gcgcgcaatacgctcaaggtcggcatcatggacgaggagcggcgcaccaccgtcaaccta
aaggcctgcatcgccgcggccagcgagcgcgtggtgttcatcaacaccggtttcctcgac
cgcaccggcgacgagatccacacctccatggaagccggcgccatggtgcgcaaggccgcc
atgaagagcgagaagtggatcagcgcctacgagaacaacaacgtcgacgtcggcctggcc
agcggcctgcagggccgtgcacagatcggcaagggcatgtgggcaatgcccgacctgatg
gccgccatgctcgaacagaagatcggccacccgctggctggcgccaacaccgcctgggtg
ccctcgccgaccgctgccaccctgcacgcactgcactatcacaaggtcgacgtgttcgcc
cgccaggccgagctgaccaagcgaaccccggcttcgctggatgaaatcctcagcattccg
ctggcgccagaaaccaactggagcgccgaggaaatccgcaacgagctggacaacaacgcc
cagggcatcctcggctacgtggtgcgctggatcgaccagggcgtcggctgctccaaggtg
ccggacatcaacgacatcggtctgatggaagaccgcgccaccctgcgcatttccagtcag
ctactggccaactggctgcgccacggcgtggtcagcgaagcgcaggtgctggaaagcctc
aagcgcatggcgccggtagtggaccggcagaatgccggcgatgcgttgtaccgcccgatg
gcgccggacttcgacagcaacatcgccttccaggcggccgtggagctggtactcgaaggt
gccaagcagcccaacggctataccgagccggtgctgcatcgccgtcgtcgtgaactgaag
gccagcctggcgcgctaa

DBGET integrated database retrieval system