KEGG   Pseudomonas fulva: Psefu_4194Help
Entry
Psefu_4194        CDS       T01501                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pfv  Pseudomonas fulva
Pathway
pfv00010  Glycolysis / Gluconeogenesis
pfv00020  Citrate cycle (TCA cycle)
pfv00620  Pyruvate metabolism
pfv01100  Metabolic pathways
pfv01110  Biosynthesis of secondary metabolites
pfv01120  Microbial metabolism in diverse environments
pfv01130  Biosynthesis of antibiotics
pfv01200  Carbon metabolism
Module
pfv_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pfv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psefu_4194
   00020 Citrate cycle (TCA cycle)
    Psefu_4194
   00620 Pyruvate metabolism
    Psefu_4194
Enzymes [BR:pfv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Psefu_4194
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding GCV_H HlyD_D23 RnfC_N NQRA HlyD_3 AstE_AspA
Motif
Other DBs
NCBI-ProteinID: AEF24146
JGI: Psefu_4194
UniProt: F6AKS2
Position
4579664..4581661
Genome map
AA seq 665 aa AA seqDB search
MSELIRVPDIGGGEGEIIELFVKVGDRIEADQSLLTLESDKASMEIPAPKAGVVKSLKVK
LGDTLKEGDELLELDVEGDAAAEVAPAKQEEPAQEAPAAAAAPAAEPQAQSTGSAESQEV
KVPDIGSSAKASIIEVAVKPGDTIEVDQSLITLESDKASMEIPSPAAGVVESVSVKVGDE
VGTGDLILVLKGAAGAQKQAASAPAPAAAPAQAQAEAPAPAAAAAAAEEPTGESTEEVRI
PDIGADAASVIEMLVKTGDSVEAEQSLITLESAKASMEIPAPKAGVIESIAIKVGDQAKT
GDLILTLKVQGKAATKPPAAAQAPAAAPEQAKPANVQGSAPAKAAPQAAPAAAPSRDGSK
VHAGPAVRQLAREFGVELSSVPGSGPKGRILKEDVQAYVKSELQKAKSAPAAAAAGATGG
AGIPPIPTVDFSKFGEVEEVPMTRLMQVGAANLHRSWLNVPHVTQFDSADITELEAFRVA
QKAVAEKAGVKLTVLPLLLKACAYLLKELPDFNSSLAPSGKAVIRKKYVHIGFAVDTPDG
LLVPVIKNVDQKSLLQLAAEAAALAEKARNKKLSADDMQGACFTISSLGHIGGTGFTPIV
NAPEVAILGVSKATIQPVWDGKAFQPKLMLPLSLSYDHRVINGAAAARFTKRLGDVLTDI
RTMLL
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgaattgattcgcgtacccgatatcggcggcggtgaaggtgaaatcatcgagctg
ttcgtcaaggtcggcgaccgcatcgaagccgaccagagcctgctgaccctcgagtcggac
aaggccagcatggaaatcccggctcccaaggccggcgtcgtcaagagcctgaaggtcaag
ctcggcgacaccctgaaagaaggtgacgagctgctcgagctggacgtggaaggcgatgct
gccgccgaagtcgccccggccaagcaagaagagcctgcccaggaggcacctgctgccgcc
gcagcgccagcggcagagccgcaagctcagtcgaccggcagcgccgagtcgcaggaagtc
aaggtgccggacatcggttccagcgccaaggccagcatcatcgaagtagcggtcaagccg
ggcgacaccatagaggtcgatcagtcgctgatcaccctcgagtccgacaaggccagcatg
gaaatcccctcgccggcagccggcgtggtggaaagcgtatcggtcaaggtcggtgacgaa
gtcggcaccggcgacctgatcctggtgctcaaaggtgccgccggcgcccagaagcaggcc
gccagcgcaccagctcctgcggccgctcccgcccaggcccaggctgaagcgccagcacct
gccgctgccgctgccgctgccgaagagccgaccggcgagagcactgaagaagtgcgcatc
ccggatatcggcgccgacgcagccagcgtcatcgagatgctggtcaagacaggcgacagc
gtggaagccgaacaatcgctgatcaccctggagtcggccaaggcgagcatggagatcccg
gcgcccaaagctggcgtgatcgaaagcatcgccatcaaggtcggtgaccaggccaagacc
ggcgacctgatcctgaccctcaaggtccagggcaaggctgctaccaaaccgcccgccgct
gcccaggcgccagccgctgctcccgagcaggccaagccggccaacgtgcagggcagcgca
ccggccaaggccgcaccgcaggctgctcctgccgccgcgccaagccgcgacggcagcaaa
gtgcacgccggcccggctgtgcgtcagctggcccgcgagttcggcgtcgagctgagttcg
gtccctggcagcggcccgaaaggtcgcatcctcaaggaagacgtgcaggcctacgtcaaa
tccgagctgcagaaagccaagtcggcacctgccgccgcagctgccggtgcaaccggtggc
gccggcattccgccgatcccgaccgtcgacttcagcaagttcggtgaagtcgaagaagtg
ccgatgacccgcctgatgcaggtcggcgccgccaacctgcaccgcagctggctgaacgtg
ccgcacgtgacccagttcgactcggccgacatcaccgagctggaagccttccgcgtcgct
cagaaagccgtcgccgagaaagccggcgtcaagctgaccgtgctgccgctgctgctcaag
gcctgcgcctatctgctcaaggagctgccggacttcaacagttcgctggcgccaagcggc
aaagcggtgatccgcaagaagtacgtgcacattggcttcgccgtcgatacgccggatggc
ctgctggtaccggtgatcaagaacgtcgaccagaagagcctgctgcaactggctgccgaa
gccgctgcattggccgagaaagcgcgcaacaagaagctgtcggctgacgacatgcagggc
gcctgcttcaccatctccagccttggtcacattggcggcaccggcttcacgccgatcgtc
aacgcgccggaagtggcgattctcggtgtcagcaaggcgaccatccagccggtatgggat
ggcaaggccttccagcccaagctgatgctgccgctgtcgctgtcctacgatcaccgtgtg
atcaacggcgccgctgctgcccgcttcaccaagcgcctgggcgatgtgctgaccgacatc
cgcaccatgctgctgtaa

DBGET integrated database retrieval system