KEGG   Pseudomonas fulva: Psefu_4194Help
Entry
Psefu_4194        CDS       T01501                                 

Definition
pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pfv  Pseudomonas fulva
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pfv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Psefu_4194
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psefu_4194
   00020 Citrate cycle (TCA cycle)
    Psefu_4194
   00620 Pyruvate metabolism
    Psefu_4194
Enzymes [BR:pfv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Psefu_4194
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4579664..4581661
Genome map
AA seq 665 aa AA seqDB search
MSELIRVPDIGGGEGEIIELFVKVGDRIEADQSLLTLESDKASMEIPAPKAGVVKSLKVK
LGDTLKEGDELLELDVEGDAAAEVAPAKQEEPAQEAPAAAAAPAAEPQAQSTGSAESQEV
KVPDIGSSAKASIIEVAVKPGDTIEVDQSLITLESDKASMEIPSPAAGVVESVSVKVGDE
VGTGDLILVLKGAAGAQKQAASAPAPAAAPAQAQAEAPAPAAAAAAAEEPTGESTEEVRI
PDIGADAASVIEMLVKTGDSVEAEQSLITLESAKASMEIPAPKAGVIESIAIKVGDQAKT
GDLILTLKVQGKAATKPPAAAQAPAAAPEQAKPANVQGSAPAKAAPQAAPAAAPSRDGSK
VHAGPAVRQLAREFGVELSSVPGSGPKGRILKEDVQAYVKSELQKAKSAPAAAAAGATGG
AGIPPIPTVDFSKFGEVEEVPMTRLMQVGAANLHRSWLNVPHVTQFDSADITELEAFRVA
QKAVAEKAGVKLTVLPLLLKACAYLLKELPDFNSSLAPSGKAVIRKKYVHIGFAVDTPDG
LLVPVIKNVDQKSLLQLAAEAAALAEKARNKKLSADDMQGACFTISSLGHIGGTGFTPIV
NAPEVAILGVSKATIQPVWDGKAFQPKLMLPLSLSYDHRVINGAAAARFTKRLGDVLTDI
RTMLL
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgaattgattcgcgtacccgatatcggcggcggtgaaggtgaaatcatcgagctg
ttcgtcaaggtcggcgaccgcatcgaagccgaccagagcctgctgaccctcgagtcggac
aaggccagcatggaaatcccggctcccaaggccggcgtcgtcaagagcctgaaggtcaag
ctcggcgacaccctgaaagaaggtgacgagctgctcgagctggacgtggaaggcgatgct
gccgccgaagtcgccccggccaagcaagaagagcctgcccaggaggcacctgctgccgcc
gcagcgccagcggcagagccgcaagctcagtcgaccggcagcgccgagtcgcaggaagtc
aaggtgccggacatcggttccagcgccaaggccagcatcatcgaagtagcggtcaagccg
ggcgacaccatagaggtcgatcagtcgctgatcaccctcgagtccgacaaggccagcatg
gaaatcccctcgccggcagccggcgtggtggaaagcgtatcggtcaaggtcggtgacgaa
gtcggcaccggcgacctgatcctggtgctcaaaggtgccgccggcgcccagaagcaggcc
gccagcgcaccagctcctgcggccgctcccgcccaggcccaggctgaagcgccagcacct
gccgctgccgctgccgctgccgaagagccgaccggcgagagcactgaagaagtgcgcatc
ccggatatcggcgccgacgcagccagcgtcatcgagatgctggtcaagacaggcgacagc
gtggaagccgaacaatcgctgatcaccctggagtcggccaaggcgagcatggagatcccg
gcgcccaaagctggcgtgatcgaaagcatcgccatcaaggtcggtgaccaggccaagacc
ggcgacctgatcctgaccctcaaggtccagggcaaggctgctaccaaaccgcccgccgct
gcccaggcgccagccgctgctcccgagcaggccaagccggccaacgtgcagggcagcgca
ccggccaaggccgcaccgcaggctgctcctgccgccgcgccaagccgcgacggcagcaaa
gtgcacgccggcccggctgtgcgtcagctggcccgcgagttcggcgtcgagctgagttcg
gtccctggcagcggcccgaaaggtcgcatcctcaaggaagacgtgcaggcctacgtcaaa
tccgagctgcagaaagccaagtcggcacctgccgccgcagctgccggtgcaaccggtggc
gccggcattccgccgatcccgaccgtcgacttcagcaagttcggtgaagtcgaagaagtg
ccgatgacccgcctgatgcaggtcggcgccgccaacctgcaccgcagctggctgaacgtg
ccgcacgtgacccagttcgactcggccgacatcaccgagctggaagccttccgcgtcgct
cagaaagccgtcgccgagaaagccggcgtcaagctgaccgtgctgccgctgctgctcaag
gcctgcgcctatctgctcaaggagctgccggacttcaacagttcgctggcgccaagcggc
aaagcggtgatccgcaagaagtacgtgcacattggcttcgccgtcgatacgccggatggc
ctgctggtaccggtgatcaagaacgtcgaccagaagagcctgctgcaactggctgccgaa
gccgctgcattggccgagaaagcgcgcaacaagaagctgtcggctgacgacatgcagggc
gcctgcttcaccatctccagccttggtcacattggcggcaccggcttcacgccgatcgtc
aacgcgccggaagtggcgattctcggtgtcagcaaggcgaccatccagccggtatgggat
ggcaaggccttccagcccaagctgatgctgccgctgtcgctgtcctacgatcaccgtgtg
atcaacggcgccgctgctgcccgcttcaccaagcgcctgggcgatgtgctgaccgacatc
cgcaccatgctgctgtaa

DBGET integrated database retrieval system