KEGG   Pseudomonas fulva: Psefu_4306Help
Entry
Psefu_4306        CDS       T01501                                 

Definition
phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain II
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
pfv  Pseudomonas fulva
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pfv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psefu_4306
   00030 Pentose phosphate pathway
    Psefu_4306
   00051 Fructose and mannose metabolism
    Psefu_4306
   00052 Galactose metabolism
    Psefu_4306
   00500 Starch and sucrose metabolism
    Psefu_4306
   00520 Amino sugar and nucleotide sugar metabolism
    Psefu_4306
  Nucleotide metabolism
   00230 Purine metabolism
    Psefu_4306
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Psefu_4306
Enzymes [BR:pfv01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Psefu_4306
    5.4.2.8  phosphomannomutase
     Psefu_4306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4697202..4699775
Genome map
AA seq 857 aa AA seqDB search
MKGFKRAPKEERPGDSQPAPRSQAKASADLLPGVIAAALGVALAGAILWFAAVSPAQQVQ
QQQLSQAWGSGQAASLQQALKQLSADTLAAARNPALAQALQSGDDAQVRNAENGLRYWNG
VVDAQLNLPGQAVPDSSRAAPMNFAALDLLRRLEAGQAPAVEAYKVGERWLAYSVAPVRQ
DDKQPMVGTLLLAVDLNRLLGNLPPLPADVGQIQLVQRFDAGAAQVLAQRGQAEGTPQAF
ATGNPHWTLNFTPAAGLGNTGLSPALLGLALLVALAGALIGLLLVNRGLQQRLARDVAQL
SELVKELSAGKAVKAFSLSLPALNNLAQNLSRLPRRAQYPVATRPEPAASEAPSNRVAAK
PADFVNPLFQDTDILDIDILDDDQDLLGLEQTPIMSAPQAPKLPADIFRAYDIRGVVGAG
LTPETAYWIGRAIGSQSLAEGEPNVAVGRDGRLSGPSLVEQLIQGVADSGCHVSDVGMVP
TPVVYFAAHVLAGKTAVMLTGSHNPPDYNGFKIVIAGDTLANEQIQALKNRIDNNDLSSG
EGSVERVDLLPRYLEQIRSDIAMAKPLRVVVDCGNGAAGVIAPQLIEALGCTVIPLYCEV
DGNFPNHHPDPGKPENLVDLIAKVKEENADVGLAFDGDGDRVGVVTNTGTIVYPDRLLML
FAKDVVSRNPGADIIFDVKCTRRLTPLISGYGGRPVMWKTGHSLIKKKMKETGALLAGEM
SGHVFFKERWFGFDDGIYAAARLLEILSQDKRTAEQVFAAFPNDVSTPEINVQVTEQTKF
PIIERLQREGQWGEGSVTNLDGVRVDYPKGWGLVRASNTTPVLVLRFEAESQAELERIQE
LFRSQMHRVAPDVQLPF
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggcttcaaacgcgcgcccaaggaagaacgccccggcgactcgcaacccgctcct
cgtagccaggccaaggcctcggccgatctgctgcccggcgtgatcgccgccgcccttggc
gtggccctggccggcgctatcctgtggttcgccgcggtgagcccggcgcagcaggtgcag
cagcaacagctcagccaggcctggggcagcggccaggcagccagcctgcagcaggctctg
aagcaactcagcgccgacaccctggctgccgcgcgcaacccggcgctggcccaggcactg
caaagcggcgacgacgcccaggtgcgcaatgccgagaacggcctgcgctactggaatggc
gtggtcgacgcccagctcaacctgcctggccaggcagttccggacagctcgcgcgccgcg
ccgatgaacttcgctgcgctggatctgctgcgccgcctggaagccggtcaggcgcccgcc
gtggaagcctacaaagtcggtgagcgctggctggcctacagcgtggcgccggtgcgtcag
gacgacaaacagccgatggtcggcaccctgctgctggccgtcgacctcaaccgcctgctc
ggtaacctgccaccgctgccggcggacgtcgggcaaatccagctggtgcagcgcttcgac
gccggcgctgcccaggtgctggcccagcgcggccaggccgagggcacgccccaggcgttc
gccaccggtaatccgcactggacgctgaacttcacgccggccgccggccttggcaacacg
ggcctgtcgcccgcgctgctggggctcgccctgctggtcgccctggccggtgcgctgatc
ggcctgctgctggtcaaccggggcctgcagcagcgcctggcgcgcgacgtcgcgcaactg
agcgaattggtaaaagaactctccgcgggcaaagccgtcaaagccttcagcttgagcctg
cccgccctgaacaacctggcgcagaacctgagccgactgccccgtcgcgcccagtacccc
gtggcgacccgcccggagcccgctgccagtgaagcacccagtaatcgcgtcgcagccaag
ccggcggatttcgtgaatccgctgtttcaagacaccgatattctcgatatcgatatcctc
gacgacgaccaggatctcctgggactggagcagacaccgatcatgagcgcgccgcaagcc
ccgaaactcccagcagacatcttccgagcctatgacatccgtggtgtggtaggcgcaggc
ctgaccccggaaaccgcctattggatcggccgcgccatcggctcccagagcctggccgag
ggcgagcccaacgtcgccgttggccgcgatggccgcctgtccggcccgagcctggtggag
cagctgattcagggcgtggccgacagcggctgccacgtcagcgacgtcggcatggtgccg
actccggtggtctacttcgccgcccacgtgctggctggcaagactgcggtgatgctcacc
ggcagccacaacccgccggactacaacggcttcaagatcgtcatcgccggcgataccctg
gccaatgagcagatccaggcgctgaagaaccgtatcgacaacaacgacctgagcagcggt
gaaggcagcgtcgaacgcgtcgacctgttgccgcgctacctggagcagatccgcagcgac
atcgccatggccaagccactgcgcgtggtggtcgattgcggcaacggcgccgccggcgtc
atcgccccgcagctgatcgaggcgctgggctgcaccgtgatcccgctgtactgcgaggtc
gacggcaacttccccaaccaccatccggatccgggcaagcccgagaacctggtcgacctg
atcgccaaggtcaaggaagagaacgccgatgtcggcctggccttcgacggcgatggcgac
cgcgtaggcgtggtcaccaacaccggcaccatcgtctacccggatcgcctgctgatgctg
ttcgccaaggacgtggtgtcgcgcaacccgggcgccgacatcatcttcgacgtcaaatgc
acccgccgcctgaccccgctgatcagcggctacggtggccgcccggtgatgtggaagacc
ggccactcgctgatcaagaagaagatgaaggaaaccggcgccctgctggccggcgaaatg
agcggtcatgtgttcttcaaggagcgctggttcggtttcgacgacggcatctacgccgcc
gcgcgcctgctggagattctcagccaggacaaacgcaccgccgagcaggtgttcgccgcg
ttccccaacgacgtgtcgaccccggaaatcaacgtgcaggtcaccgagcagaccaagttc
ccgatcatcgagcgcctgcagcgtgaaggtcagtggggcgaaggcagtgtgaccaacctc
gacggtgtgcgcgtcgattaccccaaaggctggggcctggtgcgtgcatccaacaccacg
ccggtgctggtgctgcgcttcgaagcggaaagccaggccgagctggagcggattcaggag
ctgttccgctcgcagatgcaccgcgtcgcccctgacgtccaactaccgttctga

DBGET integrated database retrieval system