KEGG   Pseudomonas fulva: Psefu_4311Help
Entry
Psefu_4311        CDS       T01501                                 

Definition
aldose-1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pfv  Pseudomonas fulva
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pfv00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4704554..4705450
Genome map
AA seq 298 aa AA seqDB search
MSTSNERIQLGDLACWRIQHAGAELVVSEQGAQILRYQPAQGEPLIWLSDEAAYKTGKSV
RGGVPVCWPWFGDLQRNPEAIRASHARPADSPAHGLVRDRDWQLIGLNTEEDGVTLSFTF
DTAAEPIAEWPHAAELQLDIHLGERLKLSLTTRNLGDSELPISQALHTYFAVSDIRQVRI
EGLEGCGYVDTLQDWKTVRQDGAVTFSGETDRIYLDTPPQLSIVDPIWKRRILMRSQGSA
SAVVWNPWIDKAKRLSQFADDAWQGMLCIEHANVLDDSLILAPGAEYRLDVTLWAQPL
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgagcacctccaacgaacgcattcaactgggcgatctggcctgctggcgcatccagcat
gccggcgccgaactcgtggtcagcgaacagggcgcgcagatcctgcgctaccagccggcc
cagggcgaaccgctgatctggctcagcgacgaggcggcctataaaaccggaaaaagcgtg
cgcggcggcgtgccggtgtgctggccctggttcggcgacctgcagcgcaatcccgaagcg
atccgcgccagccatgcgcgtccggccgattcgccggcccatggcctggtgcgtgaccgc
gactggcagctgatcggcctgaacaccgaagaagacggcgtgaccctgtcgttcaccttc
gacaccgccgccgagccgatcgccgaatggccgcatgccgccgagctgcagttggacatt
cacctcggcgagcgcctgaaacttagtctgaccacccgcaacctgggcgatagcgaactg
ccgatcagccaggcgctgcacacctacttcgcggtcagcgacattcgccaggtgcgcatc
gaaggtctggagggctgcggctacgtcgacacgttgcaggactggaaaaccgtaagacag
gacggcgcggtgaccttcagcggtgaaaccgaccgtatctacctcgatacgccgccgcaa
ctgagcatcgtcgaccccatctggaagcggcgcatcctgatgcgcagccaaggctcggcc
tcggcggtggtgtggaacccatggatcgacaaggccaagcgcctgtcgcaattcgccgat
gacgcctggcagggcatgctctgcatcgagcacgccaacgtgctggacgactcgctgatc
ctcgccccgggcgccgagtaccgcctcgacgtgacgctgtgggcgcagccactttga

DBGET integrated database retrieval system