KEGG   Pseudomonas fulva: Psefu_4382Help
Entry
Psefu_4382        CDS       T01501                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
pfv  Pseudomonas fulva
Pathway
pfv00010  Glycolysis / Gluconeogenesis
pfv00071  Fatty acid degradation
pfv00350  Tyrosine metabolism
pfv00625  Chloroalkane and chloroalkene degradation
pfv00626  Naphthalene degradation
pfv01100  Metabolic pathways
pfv01110  Biosynthesis of secondary metabolites
pfv01120  Microbial metabolism in diverse environments
pfv01130  Biosynthesis of antibiotics
pfv01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pfv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psefu_4382
  Lipid metabolism
   00071 Fatty acid degradation
    Psefu_4382
  Amino acid metabolism
   00350 Tyrosine metabolism
    Psefu_4382
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Psefu_4382
   00626 Naphthalene degradation
    Psefu_4382
Enzymes [BR:pfv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Psefu_4382
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C 2-Hacid_dh_C TrkA_N
Motif
Other DBs
NCBI-ProteinID: AEF24334
JGI: Psefu_4382
UniProt: F6AAA7
Position
4781619..4782641
Genome map
AA seq 340 aa AA seqDB search
MQQTMKAAVVHAFGEPLRLEEVKVPLPGPGQILVKIEAAGVCHTDLHAADGDWPVKPSLP
FIPGHEGVGYVAAVGTGVTRVREGDRVGVPWLYTACGCCEHCLTGWETLCAEQQNTGYSV
NGSYAEYVLADPNYVGILPGNVEFAEIAPILCAGVTVYKGLKVTGARPGQWVAISGIGGL
GHVAVQYARAMGLHVAAIDVDDAKLALARKLGASLTINARQENPAEVIQRDIGGAHGVLV
TAVSNSAFGQAIGMARRGGTVALVGLPPGDFPTPIFDVVLKAISITGSIVGTRADLQEAL
DFAGEGLVKATIHRDRLDNVNGVLEQMRAGQIEGRVVMQF
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagaccatgaaagccgccgtcgtccatgccttcggcgagccattgcggctcgaa
gaggtgaaggttcccctgcccggccccgggcagatactggtgaagatcgaggcggccggg
gtttgccataccgatctgcacgccgccgacggcgactggccggtaaagcccagcctgccg
ttcattcccggccatgaaggcgtcggctacgttgccgcggtgggtaccggcgtgacccgc
gtgcgcgaaggcgaccgggtcggcgtgccctggctgtacaccgcctgcggctgctgcgaa
cactgcctgaccggctgggaaacactctgcgccgagcagcagaacaccggctattcggtc
aacggcagctacgccgaatacgtgctggccgaccccaactatgtgggcatcctgcccggg
aacgtcgagttcgccgagatcgccccgatcctctgcgccggcgttaccgtctataagggc
ctgaaggtgaccggcgcccggcccggccagtgggtggcgatttccggcatcggcggcctc
ggtcacgtggcggtgcagtacgcccgcgccatgggcctgcacgtggccgccatcgacgtg
gatgacgccaagctggcgctggccagaaagctcggcgccagcctgaccatcaacgcccgc
caggaaaacccggccgaggtcatccagcgcgatatcggcggcgcccatggcgtactggtt
accgccgtatccaacagcgccttcggccaggccatcggcatggcccgccggggcggcacg
gtcgccctggtgggcctgccgcccggcgacttcccgacgccgatcttcgatgtggtgctc
aaggccatcagcatcaccggctccatcgtcggcacccgcgcggatctgcaggaggcgctg
gacttcgcaggcgaagggctggtgaaggcgaccattcaccgcgaccgcctggacaacgtc
aacggcgtgctcgagcagatgcgcgccggacagatcgaaggccgggtagtgatgcaattc
tga

DBGET integrated database retrieval system