KEGG   Phaeobacter inhibens: PGA1_262p00390Help
Entry
PGA1_262p00390    CDS       T02192                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
pga  Phaeobacter inhibens
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pga00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PGA1_262p00390
   00052 Galactose metabolism
    PGA1_262p00390
Enzymes [BR:pga01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     PGA1_262p00390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pPGA1_262:46465..47523
Genome map
AA seq 352 aa AA seqDB search
MPPASLSSFGSYPPHAHLPETAAGQLQWLDLENDHLRLRILNFGAITARLDLRAGDGWLP
MVLGYRDMAAYLGDPFYLGAIVGRVANRVGGAGFDLTGRRVALDANEGGNQLHGGTAGLG
RVFWDIRQVADDAVELRYTSADGENGYPGCAEIQLRIALSGGSVSYDMRASVDQATPINL
AQHNYYTLGAMGDIWEHRLQCPASTYLPLRPDGVPTGAIVPVAGTPFDFTDGQPFATLDP
QRRGTDNHVIFAKGAEGHMSEIAKLTSPNGVAMRVCSDQPGAQIYTATHLNSAVTAQEGQ
QLAPFAAVCIEPQGFPDAVNQPDFPSVIVHPGRPYHQRLSLDFSTNGADRDD
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgccgccagccagcctgtcatcttttggatcatatccgccgcacgcgcatctgccggag
actgcggctggtcagctgcaatggctggatctggaaaatgatcatctgcggcttcggatc
ctcaacttcggcgcaattacggcacgcttggatctgcgcgccggtgatggatggttgcca
atggttctgggctatcgcgatatggccgcctatctgggggatcctttctatctgggggct
attgtgggtcgggtcgccaatcgcgttggcggcgctggtttcgatctgacggggcggcgg
gttgcactggatgcaaatgagggtggtaatcagctgcatggagggacggcgggtctcggg
cgggtcttctgggatatccggcaggtcgccgatgatgcggtggagctgagatatacctca
gctgatggtgagaatggctatcccggatgcgccgaaatccagctgcggatcgcattgtct
ggcggcagcgtcagctacgatatgagggccagtgttgatcaggcgacaccaatcaacttg
gcgcagcacaattactacacgctgggtgccatgggtgacatttgggagcaccgtttgcag
tgtccggcatcaacctatctgccgctgcgcccggacggggtgccaacaggcgcgattgtg
cctgtcgcggggaccccgttcgattttaccgatgggcagccgtttgcaacgctggatcca
cagcgacgtggaaccgacaatcatgtcatctttgccaagggtgccgaggggcatatgtcg
gagatcgcgaagttgacttccccaaacggggttgccatgcgggtttgttcggatcagccg
ggtgcgcagatctatacagcaacacatctgaacagcgcagtgacggcacaggaagggcag
cagcttgcacctttcgccgctgtctgtattgagccacaggggttcccggatgcggtcaat
caacctgattttccaagcgttattgtgcatccggggcggccttatcaccagaggctgtcg
ttggatttctcaacaaatggggcagaccgggatgactga

DBGET integrated database retrieval system