KEGG   Phaeobacter inhibens: PGA1_262p02160Help
Entry
PGA1_262p02160    CDS       T02192                                 

Definition
chemotaxis response regulator protein-glutamate methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
pga  Phaeobacter inhibens
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:pga00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PGA1_262p02160
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    PGA1_262p02160
Enzymes [BR:pga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     PGA1_262p02160
Two-component system [BR:pga02022]
 CheA family
  CheA-CheYBV
   PGA1_262p02160
Bacterial motility proteins [BR:pga02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    PGA1_262p02160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pPGA1_262:233910..234914
Genome map
AA seq 334 aa AA seqDB search
MSQSLLIITTDRRFAQTLQQHMEATYPGLQVLLANNLMMAYNQAEAGQPTFAFVEDGFTK
LPEFEMMLALFSALDIRWVSVMDNQGSTPARNSSPLLDVGAGIFELTKSDNPRDFARYFD
MMVKAPRRDQASPLQKQTAGGTAGPGSDKIILIGSSTGGVEALRSVLVGFPLNCPPTLIV
QHTGKNFGRGLVSLLDRICPAKVLTADDNMTLSPGHVYVAAGQPRHMGMTPRKPYRTRFK
EGPPISGHMPSVDALFMSAVPIAKSVVATILTGMGQDGAQGLLELRKAGAKTFAQDEKSS
VVYGMPRVAWEMGAAQQQVSLARMAGTLIQACKT
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
ttgtcacagagcctattgatcatcaccacggaccggcgttttgcgcagaccctacaacaa
catatggaggccacctaccctggccttcaggtgcttttggccaacaatctgatgatggcc
tacaatcaggcggaggcgggtcagcccacttttgccttcgtcgaggatgggttcaccaaa
ctgcccgagttcgaaatgatgctggctcttttctcagcgcttgatatcaggtgggtgtct
gtaatggacaaccaggggtcaacgccagcgcgcaactcctcgccattgctggacgtcggg
gctggcatcttcgagctgacgaaatccgacaacccccgcgattttgcgcgctatttcgac
atgatggtcaaggcgccgcgccgggatcaggcctcgcctttgcaaaaacaaaccgctggc
ggcacagcaggccccggcagtgacaagattatcttgatcggctcctccaccggcggtgtg
gaagccctgcgtagtgtgctggtcggatttccgctgaactgtccgccaaccctgatcgtt
caacacactggcaagaattttggccgcgggttggtttctcttctggatcgcatttgccca
gctaaggtattgactgccgacgacaatatgacgctgtcgcctggccatgtctacgtcgcg
gccggccagccacgccacatgggtatgaccccccgaaagccgtatcgtacgcggtttaag
gaaggtcccccaatctcaggtcatatgccgtcggtcgatgcactttttatgtctgccgtg
cccatcgcaaaaagcgttgttgccacaatcttaaccggtatggggcaagatggggcgcaa
gggctgctggagcttcgcaaggccggggcaaagacctttgcgcaggacgagaaaagcagt
gtcgtctacgggatgccacgcgttgcttgggaaatgggcgccgcacagcaacaggtctcg
cttgcgcgaatggccggaacactgattcaggcttgcaagacctga

DBGET integrated database retrieval system