KEGG   Phaeobacter inhibens: PGA1_c00310Help
Entry
PGA1_c00310       CDS       T02192                                 

Definition
guanidinobutyrase (EC:3.5.3.7 3.5.3.10)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
pga  Phaeobacter inhibens
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pga00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PGA1_c00310
Enzymes [BR:pga01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     PGA1_c00310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
32919..33893
Genome map
AA seq 324 aa AA seqDB search
MASLPTDFFHPVSGMEMPRFAGLPTFMRLPHVTVSDPIIDQVQLGLVGVPWDAGTTNRPG
PRHGPRQLRDLSTMIRAGNPVTGINPFSMINCADLGDVAPNPVDIIDCMERISAFYADLK
SRDIFALTVGGDHLVSLPVLRGLASGAPVGLIQFDSHTDLFDSYFGGNKYTHGTPFRRAI
EEGLVDPKRMVQIGIRGTAYNTEDVEWGQAQGVRIIRIEEFFDRGVSDVMREVREIVGDQ
PTYCTYDIDFVDPAFAPGTGTPEVGGPNSFQALQVVRELAGVQLVGADLVEVSPPFDTNG
NTAWLGASILFEMLCVSAGAISRR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccttgcctacagacttctttcatccagtatccgggatggaaatgccccggttt
gccggtttgccaacctttatgcggctaccacatgtaacagtgtctgatccgatcattgat
caggtgcagctgggcttggttggcgtgccttgggatgccggaacaaccaatcgtccgggt
ccgcgccatggtccgcgacagctgcgcgacctttcgaccatgatccgggccgggaacccg
gtgacaggcatcaatcctttttcgatgatcaattgcgcagaccttggtgatgtcgcgccc
aacccggtcgatatcatcgactgtatggagcggatcagcgctttctatgcggatctgaaa
tctcgcgacatctttgcgctgactgtcggcggggatcacctcgtttcattacctgtctta
cgaggactggccagcggcgcgccagtggggctcattcagtttgatagtcatactgatctc
tttgacagctattttggtggaaacaaatatactcacggcaccccttttcgtcgtgcaatc
gaagaaggattggtcgatccgaagcggatggtgcagatcggcattcggggcaccgcttac
aacaccgaagatgtcgaatgggggcaggcacagggtgtgagaattattcgaattgaggag
ttttttgatcgcggtgtctcggacgtcatgcgtgaagtacgagagattgtcggtgatcag
ccaacctactgtacatacgatatcgattttgttgatccggctttcgcgcctggcacggga
acacctgaggttggggggccgaacagttttcaggccctgcaggtggtacgtgaacttgca
ggcgtccagcttgtgggagccgatctggttgaggtgtcccctccgtttgacacaaacgga
aacaccgcgtggcttggggcgtcgatcctattcgagatgctctgtgtcagtgccggtgcg
atttcgcgacgatga

DBGET integrated database retrieval system