KEGG   Phaeobacter gallaeciensis DSM 17395: PGA1_c00990Help
Entry
PGA1_c00990       CDS       T02192                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pga  Phaeobacter gallaeciensis DSM 17395
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pga00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
93706..94275
Genome map
AA seq 189 aa AA seqDB search
MTEIRSEALIAMGGNLPIGEQSVVHTLIGAVEQLSESDIRLTAVSRFYRTPCFPAGSGPD
YVNAAIAIRTILSPRDLLDLLHQVEADFARRRVQRWGMRTLDLDLIAYDDLICPDVATFE
RWKDLPLEQQMQEAPGQMLVPHPRLQDRGFVLVPLRDIAPDWRHPILGQTVRELCAALPM
SDLNEISPV
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaatccggtcagaggcgcttattgccatgggggggaacctgcctatcggcgag
cagtcggtggtccataccctcataggggctgttgaacagttgtccgaatcagacatccgg
ctgacggcggtatcgcggttctatcgtacgccctgttttccggctggatctggccctgac
tatgtgaatgcagcaatcgcaatacgcacaattctgtcaccgcgagatttgctagatctg
ttgcatcaggttgaggctgattttgcccgccgccgcgtacagcgctggggaatgcggacg
ctggatctggacctgatcgcctatgatgatttgatctgtccggatgtggcgactttcgaa
cgttggaaagatctgccgcttgaacagcaaatgcaggaggcaccggggcagatgttggta
ccgcacccacggctacaggatcgcggctttgtcctcgtaccgttgcgggatatcgcgccg
gattggcggcatccgattctcggtcagactgtccgcgagctctgcgctgcgctgccaatg
tccgatttgaatgagatttcgccggtctga

DBGET integrated database retrieval system