KEGG   Phaeobacter inhibens DSM 17395: PGA1_c03060Help
Entry
PGA1_c03060       CDS       T02192                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase PyrB
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
pga  Phaeobacter inhibens DSM 17395
Pathway
pga00240  Pyrimidine metabolism
pga00250  Alanine, aspartate and glutamate metabolism
pga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pga00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PGA1_c03060 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PGA1_c03060 (pyrB)
Enzymes [BR:pga01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     PGA1_c03060 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: AFO90039
UniProt: I7DX64
Position
complement(292804..293799)
Genome map
AA seq 331 aa AA seqDB search
MPTATSSPDPMAFSQRHLLGIEPLKPHEITAILDLADSYAELNRRPDKHANALSGLTQVN
MFFENSTRTQASFEIAGKRLGADVMNMAMQASSIKKGETLIDTAMTLNAMHPDLLVVRHP
HSGAVDLLAQKVNCAVLNAGDGRHEHPTQALLDALTIRRAKGRLHRLNIAICGDVAHSRV
ARSNLILLGKMENRIRLIGPPTLVPGHFADFGAEIYDDMREGLKDVDVVMMLRLQKERMD
GGFIPSEREYYHRYGLDAEKLALAKPDAIVMHPGPMNRGVEIDGTLADDINRSVIQEQVE
MGVAVRMAAMDLLARNLRASRERAASQPGVA
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgcccacagccacctcgtcacctgatccgatggccttttctcaacggcatcttctgggc
atcgaaccgctgaaaccgcatgaaatcaccgcgatccttgatctcgcggacagctatgca
gagctgaaccggcgtcccgacaaacacgccaatgcgctgtcggggctgacccaggtcaat
atgttctttgagaactccacccgcacgcaggccagctttgaaatcgcgggcaagcggttg
ggcgcggatgtgatgaacatggcgatgcaggcctcctcaatcaaaaagggggaaaccctg
atcgacaccgcgatgacgctgaacgcgatgcacccagatcttctggtggtgcgccatccg
cattccggcgccgtggatctcttggcgcagaaggtaaactgcgcggtactgaatgccggc
gacgggcggcatgagcaccctacacaggcgctgctggatgcgctgaccatccgccgtgca
aaaggccgtctgcaccggctgaacatcgcaatttgcggtgatgtggcccactcccgtgtg
gcgcgctcgaacctgatcctgttgggcaagatggagaaccgcatccgcctgattggcccg
ccgacactggtgcccggccactttgccgacttcggcgccgagatttacgacgacatgcgc
gaaggcctgaaagacgtggatgtggtcatgatgctgcgcctccagaaggagcgtatggat
ggcggcttcatcccgtcggagcgcgaatactaccatcgctacgggcttgatgcggagaaa
ctggcgctggccaaacccgacgccatcgtcatgcaccccggcccaatgaaccggggcgtt
gaaatcgacggcacgcttgccgatgacatcaaccgctctgtcattcaggaacaggtcgaa
atgggtgtcgccgtgcggatggcggcgatggatcttctggcccgcaacctgcgcgccagc
cgcgagcgtgcggcgtcgcaaccgggcgtggcctga

DBGET integrated database retrieval system