KEGG   Phaeobacter gallaeciensis DSM 17395: PGA1_c03060Help
Entry
PGA1_c03060       CDS       T02192                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase PyrB (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
pga  Phaeobacter gallaeciensis DSM 17395
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:pga00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:pga00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(292804..293799)
Genome map
AA seq 331 aa AA seqDB search
MPTATSSPDPMAFSQRHLLGIEPLKPHEITAILDLADSYAELNRRPDKHANALSGLTQVN
MFFENSTRTQASFEIAGKRLGADVMNMAMQASSIKKGETLIDTAMTLNAMHPDLLVVRHP
HSGAVDLLAQKVNCAVLNAGDGRHEHPTQALLDALTIRRAKGRLHRLNIAICGDVAHSRV
ARSNLILLGKMENRIRLIGPPTLVPGHFADFGAEIYDDMREGLKDVDVVMMLRLQKERMD
GGFIPSEREYYHRYGLDAEKLALAKPDAIVMHPGPMNRGVEIDGTLADDINRSVIQEQVE
MGVAVRMAAMDLLARNLRASRERAASQPGVA
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgcccacagccacctcgtcacctgatccgatggccttttctcaacggcatcttctgggc
atcgaaccgctgaaaccgcatgaaatcaccgcgatccttgatctcgcggacagctatgca
gagctgaaccggcgtcccgacaaacacgccaatgcgctgtcggggctgacccaggtcaat
atgttctttgagaactccacccgcacgcaggccagctttgaaatcgcgggcaagcggttg
ggcgcggatgtgatgaacatggcgatgcaggcctcctcaatcaaaaagggggaaaccctg
atcgacaccgcgatgacgctgaacgcgatgcacccagatcttctggtggtgcgccatccg
cattccggcgccgtggatctcttggcgcagaaggtaaactgcgcggtactgaatgccggc
gacgggcggcatgagcaccctacacaggcgctgctggatgcgctgaccatccgccgtgca
aaaggccgtctgcaccggctgaacatcgcaatttgcggtgatgtggcccactcccgtgtg
gcgcgctcgaacctgatcctgttgggcaagatggagaaccgcatccgcctgattggcccg
ccgacactggtgcccggccactttgccgacttcggcgccgagatttacgacgacatgcgc
gaaggcctgaaagacgtggatgtggtcatgatgctgcgcctccagaaggagcgtatggat
ggcggcttcatcccgtcggagcgcgaatactaccatcgctacgggcttgatgcggagaaa
ctggcgctggccaaacccgacgccatcgtcatgcaccccggcccaatgaaccggggcgtt
gaaatcgacggcacgcttgccgatgacatcaaccgctctgtcattcaggaacaggtcgaa
atgggtgtcgccgtgcggatggcggcgatggatcttctggcccgcaacctgcgcgccagc
cgcgagcgtgcggcgtcgcaaccgggcgtggcctga

DBGET integrated database retrieval system