KEGG   Phaeobacter gallaeciensis DSM 17395: PGA1_c03340Help
Entry
PGA1_c03340       CDS       T02192                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pga  Phaeobacter gallaeciensis DSM 17395
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:pga00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
320513..321349
Genome map
AA seq 278 aa AA seqDB search
MTVEAFAPAKINLTLHVTGQRADGYHLLDSLVVFADIGDRITVAVADERSLQVTGSMAAG
VPVDDSNLMMQAAALMDPARGAALSLEKNLPPASGIGGGSSDAAATLRALSGLWGLPLPG
TQDVLPLGADVPVCMSQSTQRMRGIGERLDGLPPLPDCAIVLINPGVSVATPAIFRAMGK
RDNPAMPAELPTWDSVGDLAAWLKMQRNDLQPPAIRLEPVIGTVLEELSGTDPLYHAMSG
SGATCYGLYSTDAEAEAAAGQLRSAHADWWVRAGRLLA
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgacggttgaggcatttgcccctgccaagatcaatctgaccctgcatgtgaccggccag
cgcgcggatggctatcatcttcttgattcgctggtggtttttgccgatatcggagaccgg
atcacggttgctgtggcggatgagcgatcgctgcaggtgactgggtcgatggcagcaggc
gtgccggtggatgacagcaatctgatgatgcaagccgcagcgctgatggatcctgcgcgc
ggggctgcgctgtcactggagaaaaacctgccgcctgcgtcggggatcggcggggggtcc
tctgatgcggcggcgactctccgggcgctgtctggattgtgggggctgcccctgccgggc
acgcaggatgtgcttccgctaggtgccgatgtgccggtctgtatgtcgcagagcacgcag
cggatgcgtgggataggggagcgcctggacggtctgccaccgttgccagactgcgcgatt
gtgctcataaacccgggcgtgtccgtggccacgcccgcgatttttcgcgccatgggcaaa
cgggacaatccggccatgcctgccgagcttcctacctgggactctgttggcgatctggca
gcatggcttaagatgcagcgcaacgatctgcagccgccagctatccggttggaacctgtg
atcggaacggttctggaggaactatctgggacggaccccctgtatcacgcgatgtccggg
tcgggcgcgacctgctatggtctctactcaacagatgcagaggcagaggccgccgcaggc
cagctgcggtcggcacatgctgactggtgggtgcgtgcggggcgtctgctggcctga

DBGET integrated database retrieval system