KEGG   Phaeobacter inhibens: PGA1_c03590Help
Entry
PGA1_c03590       CDS       T02192                                 

Gene name
sucB
Definition
dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pga  Phaeobacter inhibens
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PGA1_c03590 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PGA1_c03590 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    PGA1_c03590 (sucB)
Enzymes [BR:pga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PGA1_c03590 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(344209..345759)
Genome map
AA seq 516 aa AA seqDB search
MTTEVRVPTLGESVTEATVATWFKKPGDAVAADEMLCELETDKVTVEVPAPAAGTLGEIV
AAEGETVGVDALLATIAEGGSDTAAAPATSAPAATKDAAEGDAGAATDVMVPTLGESVSE
ATVSTWFKKVGDSVAQDEMLCELETDKVSVEVPAPTAGILTEITAEEGSTVDATAKLGVI
SGGEAGAVTPTPSKGETAGGAQYTTPPAGQGGPAKDIANAPSAEKAMAEAGLSADQVQGS
GRDGRIMKDDVARAVAAAAAAPAASTSAPAAAAPVRAPVAADDAAREERVKMTRLRQTIA
KRLKDSQNTAAMLTTYNEVDMTEVMALRNEYKDLFLKKHGVKLGFMSFFTKACVHALNEV
PEVNAEIDGTDIVYKNFVHMGIAAGTPTGLVVPVIRDADAMSFADIEKAIAEKGARARDG
KLSMAEMQGGTFTISNGGVYGSLMSSPILNPPQSGILGMHKIQDRPMAINGKVEIRPMMY
LALSYDHRIVDGKGAVTFLVRVKEALEDPRRLLMDL
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgaagttcgcgtgcccaccctgggcgaatccgtgaccgaagccaccgtcgcc
acctggttcaaaaagccgggtgacgcggtcgccgcagatgaaatgctctgcgagctggaa
accgacaaagtcaccgttgaagtcccggcccctgccgccggcaccctgggtgagatcgtc
gccgccgagggcgaaaccgtcggcgtcgatgcgctgcttgccacgatcgcagaaggcggt
tctgacacagcggcagcccctgcaacatccgcaccagccgccacgaaggacgcagcagaa
ggtgatgcaggcgccgcaaccgacgtgatggtgccaacgcttggcgagtccgtgagcgag
gccactgtttccacctggttcaagaaggtcggcgacagtgtcgcgcaggacgaaatgctc
tgcgagctggaaactgataaggtctcggttgaagtcccagccccgactgccggtatcctg
accgaaatcacagctgaagaaggcagcaccgtcgatgcgacggccaaacttggcgtgatc
tcaggtggcgaagcaggtgccgtaacgcctacgcccagcaagggcgaaaccgcaggtggg
gcgcaatataccacgccccccgcaggccagggcggtccggccaaggatatcgcaaatgct
ccttccgccgagaaggcaatggctgaggccggtctctctgcagatcaggtgcaaggcagc
ggtcgtgatggccgcatcatgaaggacgacgtcgcccgtgccgtggccgctgccgcagct
gcgccggctgccagcacctcggccccagcagcggcggcacctgtgcgcgcgccggttgct
gcggacgacgccgcccgtgaagagcgcgtgaaaatgacacgcctgcgccagaccatcgcc
aagcgtctgaaggacagtcagaacaccgctgccatgctcaccacctacaacgaggtcgac
atgaccgaggtgatggccctgcgcaacgagtacaaggacctgttcctgaagaaacacggc
gtgaaactgggcttcatgtcgttctttaccaaggcctgcgtgcacgccctgaacgaggtc
cctgaggtcaacgccgagatcgacggcaccgacatcgtctacaagaacttcgtccacatg
ggcatcgccgctggcacgcccacgggcctggtcgttccggtcatccgcgacgccgatgcg
atgtcgttcgcggacatcgagaaggcgatcgctgaaaagggtgcccgcgcccgtgacggc
aagctgtcaatggcagagatgcagggcggcaccttcaccatctccaacggtggtgtctac
ggctcgctgatgtcctcgccgatcctgaacccaccgcaatccggcatcctgggcatgcac
aagatccaggaccgcccgatggcgatcaacggcaaggtggaaattcgcccgatgatgtat
ctggcactgagctatgatcaccgtatcgttgacggcaaaggtgctgtgaccttcctcgtg
cgcgtcaaggaagcgctggaagacccgcgccgcctgctgatggatctgtaa

DBGET integrated database retrieval system