KEGG   Phaeobacter inhibens DSM 17395: PGA1_c03630Help
Entry
PGA1_c03630       CDS       T02192                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA ligase [ADP-forming] subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pga  Phaeobacter inhibens DSM 17395
Pathway
pga00020  Citrate cycle (TCA cycle)
pga00640  Propanoate metabolism
pga00660  C5-Branched dibasic acid metabolism
pga01100  Metabolic pathways
pga01110  Biosynthesis of secondary metabolites
pga01120  Microbial metabolism in diverse environments
pga01130  Biosynthesis of antibiotics
pga01200  Carbon metabolism
Module
pga_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pga_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pga00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PGA1_c03630 (sucC)
   00640 Propanoate metabolism
    PGA1_c03630 (sucC)
   00660 C5-Branched dibasic acid metabolism
    PGA1_c03630 (sucC)
Enzymes [BR:pga01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PGA1_c03630 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: AFO90097
UniProt: I7ETR6
Position
complement(350241..351434)
Genome map
AA seq 397 aa AA seqDB search
MNIHEYQAKALLRSYGAPVSDGRVVLKAEDAKTAAGELDGPLWVVKAQIHAGGRGKGSFK
EADAGEKGGVRLTKSVEEAADEAKKMLGRTLVTHQTGPAGKQVNRIYIEAGSGIQTELYL
ALLVDRQTSRVSFVCSTEGGMDIEEVAEATPEKILSFSVDPATGYQAFHGRRIAFSLGLE
GQQIKQCVRLMGQLYKAFVEKDMEMLEINPLIVSDSGDLKVLDAKVGFDGNAVYRHADIS
ELRDTTEEDPKELEASKYDLNYIALDGEIGCMVNGAGLAMATMDIIKLYGAEPANFLDVG
GGATKEKVTEAFKIITSDPNVKGILVNIFGGIMRCDVIAEGVVAAVKEVGLKVPLVVRLE
GTNVEAGKDIINTSGLDVIAADNLSDGAEKIVKAVKG
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccacgaatatcaggccaaggccctcctccgcagctacggcgcgccggtttcg
gacgggcgtgtggtgctcaaggcagaagatgccaaaaccgcagcaggtgagctggacggc
ccgctctgggtggtcaaagctcagatccacgctggtggtcgcggcaagggctccttcaag
gaggctgacgcgggcgaaaaaggcggcgtgcgcctgaccaaatcggttgaagaagccgct
gacgaagccaagaaaatgctgggccgcacccttgtgacccatcagaccggccccgccggt
aagcaggtgaaccgcatctacatcgaggcaggctccggcattcagaccgaactctatctc
gcgctgctggtggatcgccaaacctcgcgcgtctcctttgtctgctccaccgagggcggc
atggacatcgaggaagtggccgaagcgacccccgagaaaatcctgtccttctccgttgat
ccggcaactggctatcaggcgttccacggccgccgcatcgccttctcgctcggccttgaa
ggccagcagatcaagcaatgcgtcagactgatgggccagctttacaaggcatttgtcgaa
aaagacatggaaatgctggagatcaacccgctgatcgtctccgacagcggcgatctgaag
gtgctggacgccaaggtcggcttcgacggcaacgcggtttaccgccacgccgatatctcc
gaactgcgcgacaccaccgaggaagaccccaaggagctggaagcgtccaaatatgacctg
aactacatcgctctggacggtgagatcggttgcatggtgaacggtgcggggctggcgatg
gccaccatggacatcatcaaactctacggcgctgagcctgcgaacttcctcgatgtgggc
ggcggcgccaccaaggagaaagtgaccgaggcgttcaagatcatcacctctgacccgaac
gtcaaaggcatcctggtcaacatcttcggcggcatcatgcgctgcgacgtcatcgccgaa
ggcgtggtcgccgcggtgaaagaggtcggcctgaaggtacctctggttgtccgtcttgaa
ggcaccaacgtggaagccggcaaagacatcatcaacacctccggtcttgatgtcatcgca
gctgacaacctgtccgacggcgccgagaaaatcgtgaaagcggtgaaagggtaa

DBGET integrated database retrieval system