KEGG   Phaeobacter gallaeciensis DSM 17395: PGA1_c03750Help
Entry
PGA1_c03750       CDS       T02192                                 

Gene name
sdhD
Definition
succinate dehydrogenase hydrophobic membrane anchor subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
pga  Phaeobacter gallaeciensis DSM 17395
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:pga01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:pga00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:pga00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:pga00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
359778..360149
Genome map
AA seq 123 aa AA seqDB search
MRYLTDRKRAVGMGAAKSGTAHHWSMQVSSIGLLILVPLFVFTFGSALGGSYEEITAYYA
RPFPALVALLTIWVGMMHFKSGAQIMIEDYVHGFAGRLTIILVTCLSYAVAAVSAYALIR
LAL
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatttgacagatcgcaagcgtgccgttggcatgggtgctgcgaaatccggtaca
gcacatcactggtcgatgcaggtcagctccatcgggttgctgatcctggtgcccctgttc
gtctttacctttggctcggcgctgggcggatcctacgaagagatcaccgcctattacgcg
cgcccgtttcctgcacttgttgcactgctgaccatctgggtcggcatgatgcacttcaaa
tccggtgcgcagatcatgatcgaagactatgtccatggctttgccggtcgtctgacgatc
attctggtcacctgtctgtcttatgccgtggccgcggtcagcgcctatgcgctgatccgc
ctggcgctgtaa

DBGET integrated database retrieval system