KEGG   Phaeobacter inhibens DSM 17395: PGA1_c04870Help
Entry
PGA1_c04870       CDS       T02192                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pga  Phaeobacter inhibens DSM 17395
Pathway
pga00260  Glycine, serine and threonine metabolism
pga00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pga01100  Metabolic pathways
pga01110  Biosynthesis of secondary metabolites
pga01130  Biosynthesis of antibiotics
pga01230  Biosynthesis of amino acids
Module
pga_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pga00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PGA1_c04870 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PGA1_c04870 (trpB)
Enzymes [BR:pga01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PGA1_c04870 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFO90221
UniProt: I7DM57
Position
478592..479845
Genome map
AA seq 417 aa AA seqDB search
MAEDLFNSFMNGPDEQGRFGIFGGRFVSETLMPLILSLEEEYDRAKDDPSFWAEMDDLWK
NYVGRPSPLYFAERLTEHLGGAKIYLKRDELNHTGAHKINNVLGQILLARRMGKDRIIAE
TGAGQHGVATATVCAKFGLKCVVYMGAHDVQRQAPNVFRMRLLGAEVIPVTSGRGTLKDA
MNDALRDWVTNVHDTFYCIGTVAGPHPYPAMVRDFQSVIGKEVRWQLAEQEGEGRLPDTV
IAAIGGGSNAMGLFYPFLDDKSVNIIGVEAGGKGVDEKMQHCASLTGGRPGVLHGNRTYL
LQDDDGQILEGFSISAGLDYPGIGPEHAWLNDIGRADYVSITDKEALEAFQLSCAMEGII
PALEPSHALAHVMKIAPDLPKDHIIVMNMCGRGDKDIFTVARHLGFDMSDTEGRDSD
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagatctattcaacagcttcatgaacggtcccgatgaacaggggcggtttggt
attttcggagggcggttcgtcagcgagactttgatgccgctgatcctcagcctggaagag
gaatatgatcgtgccaaggacgacccgagtttctgggccgagatggacgatctctggaaa
aactatgttggtcggcccagtccgctctatttcgccgagcggctgactgagcatctgggc
ggcgcgaagatctatttaaaacgggatgagctgaaccataccggcgcgcataagattaac
aatgtgctgggacagatcctgctggcccgtcgcatgggtaaggatcggatcattgcggaa
accggcgcgggccagcatggcgtcgctactgccacggtctgtgccaaatttgggctgaaa
tgcgtggtctatatgggtgcgcatgatgtgcagcgtcaggcgcccaatgtcttccgtatg
cgccttctgggtgccgaagtcattccggtgacctctggccgcggcacgttgaaggatgcc
atgaacgatgccctgcgggattgggtgaccaatgtccacgacaccttctactgcatcggc
acagtggcgggaccgcatccctatccggcaatggtgcgagatttccagtcggtgatcggt
aaagaagtacgctggcagctggcagagcaggagggcgagggacgtctgccggacaccgta
atcgcagcaattggtggcgggtcaaacgccatgggcctgttctacccattcctggacgac
aagtcggtgaacatcattggtgttgaggccggtggcaaaggtgtcgatgagaagatgcag
cattgtgcctcgctcaccggtggtcgccctggcgtgctgcatggcaaccgcacctaccta
ttgcaggatgatgatggacaaattctggaaggcttttccatctctgccgggctcgattat
cccggtatcggtccggagcatgcctggttgaacgatatcggccgggccgattatgtctcc
atcactgacaaggaagcgctggaggcgttccagctatcctgcgctatggaaggcatcatt
ccggcacttgagccgagtcatgcgctggcccatgtgatgaagatcgcgcccgacttgcct
aaggaccatatcattgtgatgaacatgtgtggccgcggcgacaaggatatctttaccgtc
gcgcgtcacctcggctttgatatgtcggacaccgaaggtcgcgacagcgactga

DBGET integrated database retrieval system