KEGG   Phaeobacter gallaeciensis DSM 17395: PGA1_c04870Help
Entry
PGA1_c04870       CDS       T02192                                 

Gene name
trpB
Definition
tryptophan synthase beta chain (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pga  Phaeobacter gallaeciensis DSM 17395
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pga01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:pga00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:pga00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
478592..479845
Genome map
AA seq 417 aa AA seqDB search
MAEDLFNSFMNGPDEQGRFGIFGGRFVSETLMPLILSLEEEYDRAKDDPSFWAEMDDLWK
NYVGRPSPLYFAERLTEHLGGAKIYLKRDELNHTGAHKINNVLGQILLARRMGKDRIIAE
TGAGQHGVATATVCAKFGLKCVVYMGAHDVQRQAPNVFRMRLLGAEVIPVTSGRGTLKDA
MNDALRDWVTNVHDTFYCIGTVAGPHPYPAMVRDFQSVIGKEVRWQLAEQEGEGRLPDTV
IAAIGGGSNAMGLFYPFLDDKSVNIIGVEAGGKGVDEKMQHCASLTGGRPGVLHGNRTYL
LQDDDGQILEGFSISAGLDYPGIGPEHAWLNDIGRADYVSITDKEALEAFQLSCAMEGII
PALEPSHALAHVMKIAPDLPKDHIIVMNMCGRGDKDIFTVARHLGFDMSDTEGRDSD
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagatctattcaacagcttcatgaacggtcccgatgaacaggggcggtttggt
attttcggagggcggttcgtcagcgagactttgatgccgctgatcctcagcctggaagag
gaatatgatcgtgccaaggacgacccgagtttctgggccgagatggacgatctctggaaa
aactatgttggtcggcccagtccgctctatttcgccgagcggctgactgagcatctgggc
ggcgcgaagatctatttaaaacgggatgagctgaaccataccggcgcgcataagattaac
aatgtgctgggacagatcctgctggcccgtcgcatgggtaaggatcggatcattgcggaa
accggcgcgggccagcatggcgtcgctactgccacggtctgtgccaaatttgggctgaaa
tgcgtggtctatatgggtgcgcatgatgtgcagcgtcaggcgcccaatgtcttccgtatg
cgccttctgggtgccgaagtcattccggtgacctctggccgcggcacgttgaaggatgcc
atgaacgatgccctgcgggattgggtgaccaatgtccacgacaccttctactgcatcggc
acagtggcgggaccgcatccctatccggcaatggtgcgagatttccagtcggtgatcggt
aaagaagtacgctggcagctggcagagcaggagggcgagggacgtctgccggacaccgta
atcgcagcaattggtggcgggtcaaacgccatgggcctgttctacccattcctggacgac
aagtcggtgaacatcattggtgttgaggccggtggcaaaggtgtcgatgagaagatgcag
cattgtgcctcgctcaccggtggtcgccctggcgtgctgcatggcaaccgcacctaccta
ttgcaggatgatgatggacaaattctggaaggcttttccatctctgccgggctcgattat
cccggtatcggtccggagcatgcctggttgaacgatatcggccgggccgattatgtctcc
atcactgacaaggaagcgctggaggcgttccagctatcctgcgctatggaaggcatcatt
ccggcacttgagccgagtcatgcgctggcccatgtgatgaagatcgcgcccgacttgcct
aaggaccatatcattgtgatgaacatgtgtggccgcggcgacaaggatatctttaccgtc
gcgcgtcacctcggctttgatatgtcggacaccgaaggtcgcgacagcgactga

DBGET integrated database retrieval system