KEGG   Phaeobacter inhibens: PGA1_c04930Help
Entry
PGA1_c04930       CDS       T02192                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pga  Phaeobacter inhibens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pga00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PGA1_c04930 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PGA1_c04930 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PGA1_c04930 (trpA)
Enzymes [BR:pga01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PGA1_c04930 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(484569..485360)
Genome map
AA seq 263 aa AA seqDB search
MTRIDAKFAELKAADKKAFVAYVMAGDPDFDTSLELVKGLPAAGVDVIELGLPFTDPMAD
GPTIQLAGQRALEAGMTLQRTLDLARTFREEDNTTPIVMMGYYNPIYSRGVETFLKDAKE
AGIDGLIVVDLPPEEDSELCLPAQQAGLNFIRLATPTTDDKRLPRVLQNTSGFVYYVSIT
GITGAAEAEATNVGPEVARIKSQTDLPVIVGFGINTPEKSQAIASVADGAVVGSAIVSQI
GAGKPVGEVLSFVKSLADGAHSA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcattgacgccaaattcgccgaattgaaagctgcagacaaaaaggccttcgtt
gcctatgtcatggcgggcgaccctgacttcgacacctcgcttgaactggtcaagggcctg
cctgcggcgggcgtggacgtaattgagctgggcctgccctttaccgacccaatggccgat
ggtccaaccatccagttggccggccagcgcgcgctagaagcaggcatgacgctgcagcgc
accttggatctggcccgcaccttccgcgaagaagacaataccacgccgatcgtgatgatg
ggctactacaacccgatctacagccggggcgtcgaaacctttttgaaggacgccaaagaa
gccggtatcgacggtctgatcgttgtggatctgccccccgaagaagacagcgaactctgt
ctgcctgcgcaacaggccggtctgaattttatccggctggccaccccgaccaccgatgac
aagcgcctgccccgtgtgctgcagaacacctcaggctttgtctactatgtgtcgatcact
gggatcaccggcgccgctgaagcagaagccaccaatgtcggtcccgaagtggcccgcatc
aaatcacagacagatctgcccgtcatcgtcggcttcggcatcaatacacccgagaaatca
caagccatcgcatccgttgcagatggcgccgtagtcggctcggcgattgtcagccagatt
ggcgctggcaaacccgtgggtgaggtcctcagcttcgtcaagtctctcgcagacggtgcg
cattccgcctaa

DBGET integrated database retrieval system