KEGG   Phaeobacter inhibens DSM 17395: PGA1_c05420Help
Entry
PGA1_c05420       CDS       T02192                                 

Gene name
glk
Definition
(GenBank) glucokinase Glk
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
pga  Phaeobacter inhibens DSM 17395
Pathway
pga00010  Glycolysis / Gluconeogenesis
pga00052  Galactose metabolism
pga00500  Starch and sucrose metabolism
pga00520  Amino sugar and nucleotide sugar metabolism
pga00521  Streptomycin biosynthesis
pga01100  Metabolic pathways
pga01110  Biosynthesis of secondary metabolites
pga01120  Microbial metabolism in diverse environments
pga01130  Biosynthesis of antibiotics
pga01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pga00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PGA1_c05420 (glk)
   00052 Galactose metabolism
    PGA1_c05420 (glk)
   00500 Starch and sucrose metabolism
    PGA1_c05420 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    PGA1_c05420 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PGA1_c05420 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    PGA1_c05420 (glk)
Enzymes [BR:pga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PGA1_c05420 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: AFO90274
UniProt: I7DXX1
Position
549868..550818
Genome map
AA seq 316 aa AA seqDB search
MGSDMTVLVGDVGGSNTRLALAGPEIGVTALQSFANDSFSSLDDVLAAYCAQPDLPPLAG
ACIAVAGPVYGNEYQLTNRNWQGSAADLAQQLQLGAGARVDVINDLAALGHSLLALIPGQ
LSSLRAGHQRGTQALVAGIGTGFNVSLSVDGHTAEAEMGHTSLSAPVTRGLTDLLGDRAG
EFATNEDLFSGRGLVRYHQALHGIAAEGGAQIVADYLADGDSPAAKTVTSWARLLGDFAR
ELVPTYMPGQGIFFAGSVARGILGTAACEVFLNSFLQPATGVQSRCETTPLWLITDDAAG
VSGAARFALERAGRKS
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgggctcggatatgacagtgctggttggcgacgtgggcggtagcaatacccggctggcc
ctcgccgggcctgaaatcggggtcactgccctgcaaagctttgccaacgatagcttttct
agtctggatgacgtcttggctgcctattgtgcgcagcctgacctgccgccgttggctggt
gcctgcatcgccgttgcggggcctgtttatggcaatgagtatcagctgaccaatcgcaac
tggcagggtagtgctgcggatctcgcgcagcagttgcagcttggtgcgggcgcgcgggtt
gatgtgatcaacgatctggccgcgcttggacattcgctgctcgcgctgatcccgggccag
ctgtcgtcgctgcgtgcagggcatcagcggggaacgcaggcgctggtggcgggcattggc
accggttttaatgtgtcgctgtcagtggatggtcacaccgcagaggcggagatgggccac
accagcctttcggcccctgttacacgtggtctgacggatctgcttggcgaccgggcaggt
gagttcgccaccaatgaagacctgttttcggggcgggggctggtgcggtatcatcaggcg
ctgcacggtatcgcggccgaaggtggcgcgcagatcgtggcggattacctcgccgatggc
gacagccctgcggccaaaaccgtaaccagctgggcgcggctcctcggcgattttgcccgc
gagctggtgccgacctatatgccggggcaggggattttctttgctggcagcgtggcacgt
ggcattcttggcaccgccgcctgtgaggtgttcctcaacagtttcctgcaacccgccacc
ggggtacagagccgctgtgaaaccacgccgctctggctgatcaccgatgatgcagccggt
gtcagcggtgcggcgcgtttcgcgcttgaaagagccggtcgcaagagctga

DBGET integrated database retrieval system