KEGG   Phaeobacter inhibens: PGA1_c05420Help
Entry
PGA1_c05420       CDS       T02192                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pga  Phaeobacter inhibens
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PGA1_c05420 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PGA1_c05420 (glk)
   00052 Galactose metabolism
    PGA1_c05420 (glk)
   00500 Starch and sucrose metabolism
    PGA1_c05420 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    PGA1_c05420 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PGA1_c05420 (glk)
   00524 Butirosin and neomycin biosynthesis
    PGA1_c05420 (glk)
Enzymes [BR:pga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PGA1_c05420 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
549868..550818
Genome map
AA seq 316 aa AA seqDB search
MGSDMTVLVGDVGGSNTRLALAGPEIGVTALQSFANDSFSSLDDVLAAYCAQPDLPPLAG
ACIAVAGPVYGNEYQLTNRNWQGSAADLAQQLQLGAGARVDVINDLAALGHSLLALIPGQ
LSSLRAGHQRGTQALVAGIGTGFNVSLSVDGHTAEAEMGHTSLSAPVTRGLTDLLGDRAG
EFATNEDLFSGRGLVRYHQALHGIAAEGGAQIVADYLADGDSPAAKTVTSWARLLGDFAR
ELVPTYMPGQGIFFAGSVARGILGTAACEVFLNSFLQPATGVQSRCETTPLWLITDDAAG
VSGAARFALERAGRKS
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgggctcggatatgacagtgctggttggcgacgtgggcggtagcaatacccggctggcc
ctcgccgggcctgaaatcggggtcactgccctgcaaagctttgccaacgatagcttttct
agtctggatgacgtcttggctgcctattgtgcgcagcctgacctgccgccgttggctggt
gcctgcatcgccgttgcggggcctgtttatggcaatgagtatcagctgaccaatcgcaac
tggcagggtagtgctgcggatctcgcgcagcagttgcagcttggtgcgggcgcgcgggtt
gatgtgatcaacgatctggccgcgcttggacattcgctgctcgcgctgatcccgggccag
ctgtcgtcgctgcgtgcagggcatcagcggggaacgcaggcgctggtggcgggcattggc
accggttttaatgtgtcgctgtcagtggatggtcacaccgcagaggcggagatgggccac
accagcctttcggcccctgttacacgtggtctgacggatctgcttggcgaccgggcaggt
gagttcgccaccaatgaagacctgttttcggggcgggggctggtgcggtatcatcaggcg
ctgcacggtatcgcggccgaaggtggcgcgcagatcgtggcggattacctcgccgatggc
gacagccctgcggccaaaaccgtaaccagctgggcgcggctcctcggcgattttgcccgc
gagctggtgccgacctatatgccggggcaggggattttctttgctggcagcgtggcacgt
ggcattcttggcaccgccgcctgtgaggtgttcctcaacagtttcctgcaacccgccacc
ggggtacagagccgctgtgaaaccacgccgctctggctgatcaccgatgatgcagccggt
gtcagcggtgcggcgcgtttcgcgcttgaaagagccggtcgcaagagctga

DBGET integrated database retrieval system