KEGG   Phaeobacter gallaeciensis DSM 17395: PGA1_c06540Help
Entry
PGA1_c06540       CDS       T02192                                 

Gene name
folP
Definition
dihydropteroate synthase FolP (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
pga  Phaeobacter gallaeciensis DSM 17395
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pga00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
672070..673011
Genome map
AA seq 313 aa AA seqDB search
MSLISGALWFTQVEVLDRGAPPRLMPAGLLPEDVRHRLTARRATIAGLDMTQPQIMGILN
VTPDSFSDGGQHDEVGTACAIALQMVADGASIIDVGGESTRPGAVLVPEEEEIRRTAPVI
AAIRAKSQVPISIDTRKAVVLAEALEAGASLTNDVSGFTFDPALAPLTAQAGVPACIMHA
QGDPATMQDSPTYDNVLLDVYDFLKAQIDRLEDIGVVREQIVIDPGIGFGKTLEHNLILL
RSLSLFHGLGCPILLGVSRKGFIGKLGHEPDAAARAPGSIAVGLAALAQGVQFLRVHDVA
ETVQAVRLWQAVR
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgctgatcagtggcgctctttggtttactcaagtcgaagttctggaccgcggtgcg
ccgccacggctgatgcctgcagggctgctgcccgaagatgtccggcaccggctgaccgcg
cgccgcgcgacgatcgctgggctggatatgacccagccgcagatcatgggcattctgaat
gtgacgcctgacagtttttccgatggtggtcagcacgatgaggttggcacggcctgcgcg
attgcgctgcagatggtggctgatggtgccagtattatcgatgttggcggcgaatccacc
cgccccggtgctgttctggtccctgaggaggaggagattcgtcgcaccgcgccggtgatc
gccgcgatccgagccaagtcgcaggttccgatttccatcgacacccgcaaggccgtggtg
ctggcagaggcgctagaagctggcgcaagcctcaccaatgatgtgtccggctttaccttt
gacccggcgctggccccgttgacggcccaggccggggtacctgcctgtatcatgcatgcg
cagggcgatcccgcgacgatgcaggacagtccgacctatgacaatgtgttgctcgacgtc
tatgattttctcaaagcgcagattgaccggctggaggatatcggtgtcgtgcgcgaacag
atcgtgattgatcccggtatcggcttcggcaagacgctggagcacaatctgatcctgttg
cgtagtctcagcctgtttcacggccttggctgtccgatcctgctgggcgtgtcccgcaag
gggttcattggcaagctggggcatgagccggatgccgccgcccgcgcgccgggctctatt
gcggtagggcttgcagccctggcccaaggcgtgcaattcctgcgggtgcatgatgttgct
gagacggtgcaggcggttcgcctgtggcaggccgtccgataa

DBGET integrated database retrieval system