KEGG   Phaeobacter inhibens: PGA1_c07330Help
Entry
PGA1_c07330       CDS       T02192                                 

Gene name
bgaB
Definition
beta-galactosidase 1 (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
pga  Phaeobacter inhibens
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:pga00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PGA1_c07330 (bgaB)
Enzymes [BR:pga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     PGA1_c07330 (bgaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(754733..756652)
Genome map
AA seq 639 aa AA seqDB search
MQRTLGTCYYPEHWPEDIWQEDAARMVAAGLTWVRIGEFSWSRIEPNPGDLQWDWLDRAI
DTLVAAGLKVVLGTPTATPPRWMVDRHPDMFALDADGRSRGFGSRRHYCFSHTGYRAEAR
RIVTLMAERYGPGDRIAAWQTDNEYGCHDTTISYSPAAAAAFTHWLEVRFNGDICALNAA
WGNVFWSMEYERFDQIGLPNLTVTEPNPAHVQAFRRFSSDQVVSFNRDQVEILRAHSDAP
IAHNYMGRVTDFDHYKVGEDLEIASWDSYPLGFLEDRVGASAEDQRRYARQGDPDFQAFH
HDLYRAVGRGRWWVMEQQPGPVNWAPYNPAPLPGMVRFWTWEAFAHGAEAVCYFRWRQAP
FAQEQLHAGLLRPDSAETPAMIEARQVAEELTSADEVAPSQAPVALLFDYDAEWAWQVQP
HGKGLSYFDLVLDHYRALRRAGLSIDIVPPTQTDFTGYELILAPGLVHLPDDLRGALADA
TGLRLYGPRTAARDEDFRIPTSPLPPALQGLDIVVAAVESLRPDMPLPLANGDGAVVGYL
ETLDGEGSVLIETSAGHAVAVAADNQVYCAGWLDPLGLDHLIATLCARAGVNIRKMPEGV
RMRQTATEEFWFNHLAEPVETEVGTLPPAGILRRAREEA
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgcacacttggcacctgctactatccagaacattggccggaagacatctggcag
gaggacgccgcgcgcatggtcgcggcggggctgacctgggtccgcattggcgagttctcc
tggtcacgaatagaacccaaccccggtgatctgcaatgggactggctggatcgcgccatc
gacacattggtcgcggcgggattgaaagtggtgctgggcacccccaccgccaccccgccc
cggtggatggtggaccgccacccggatatgtttgcactcgatgcagatggcagatcgcgc
ggctttggctcgcgtcggcactattgtttcagccatacaggctaccgtgcagaggcccga
cggatcgtcaccctgatggcggaacgctacggcccgggcgatcgcatcgccgcatggcaa
acggacaatgaatacggctgccacgacaccacgataagctactccccggccgcagccgcc
gccttcacccactggcttgaggtccgtttcaacggtgacatttgcgcgctgaacgctgcc
tgggggaacgtgttctggtcgatggagtatgagcgctttgaccagatcggtctgccgaac
ctcaccgtgaccgaaccaaaccctgcccatgtccaggcatttaggcggttttcatcggac
caggttgtcagcttcaaccgcgatcaggtggagatcctgcgcgcccattccgacgcgccg
attgcgcataactatatgggacgagtaaccgactttgaccactacaaggtcggagaggat
ctggagatcgccagctgggacagctacccgttgggctttctagaggaccgggttggtgcc
agtgccgaggatcagcgccggtatgcgcgacagggtgacccggattttcaggcctttcat
catgacctctaccgtgccgtggggcgcgggcgttggtgggtgatggaacagcagcccggc
ccggtaaactgggcgccctacaatcccgctcccctgcccggcatggtgcggttctggacc
tgggaggcctttgcccatggagcggaggcggtctgctatttccgctggcgccaggcccct
tttgcgcaggagcaactccatgccggattgctgcgtcccgatagtgcagagacccccgcc
atgatcgaggcccgtcaggttgccgaagaactgacaagcgcagatgaggttgcgccatcg
caggctcctgtggcgctgctcttcgactatgatgcagaatgggcctggcaggtgcagcca
catggtaaaggtctgagttacttcgaccttgtgctggatcactaccgagccctgcgtcgc
gcgggtctgtctattgacatcgttccgccgacccaaaccgatttcaccggatatgagctg
atccttgcccctggtctggtacacctaccggatgacctgcgtggggcactggccgacgcg
acaggtctgcgcctctatggtccgcgaacagctgcgcgggatgaggatttcaggattcca
acctcgccgctaccgcctgccctgcaggggctggatattgtcgtcgcagcggtcgaaagc
ctccgaccggatatgccgctgccactcgcaaacggcgacggcgcagttgtcggctatctg
gaaacactggatggcgagggaagtgttctgatcgaaacctcagctgggcacgctgtcgct
gtcgctgcggacaatcaggtctattgtgccgggtggctggatccgttgggcctagatcac
ttgatcgcaacgctctgcgcccgtgcgggcgtgaacatccgcaaaatgcccgagggtgta
cgtatgcgccagaccgcgacggaggaattctggttcaaccacctcgccgagccggtagaa
acagaagtcggcacgctcccgcctgcaggaatcctgcgcagggcgcgcgaagaggcctaa

DBGET integrated database retrieval system