KEGG   Phaeobacter gallaeciensis DSM 17395: PGA1_c07330Help
Entry
PGA1_c07330       CDS       T02192                                 

Gene name
bgaB
Definition
beta-galactosidase 1 (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
pga  Phaeobacter gallaeciensis DSM 17395
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pga00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(754733..756652)
Genome map
AA seq 639 aa AA seqDB search
MQRTLGTCYYPEHWPEDIWQEDAARMVAAGLTWVRIGEFSWSRIEPNPGDLQWDWLDRAI
DTLVAAGLKVVLGTPTATPPRWMVDRHPDMFALDADGRSRGFGSRRHYCFSHTGYRAEAR
RIVTLMAERYGPGDRIAAWQTDNEYGCHDTTISYSPAAAAAFTHWLEVRFNGDICALNAA
WGNVFWSMEYERFDQIGLPNLTVTEPNPAHVQAFRRFSSDQVVSFNRDQVEILRAHSDAP
IAHNYMGRVTDFDHYKVGEDLEIASWDSYPLGFLEDRVGASAEDQRRYARQGDPDFQAFH
HDLYRAVGRGRWWVMEQQPGPVNWAPYNPAPLPGMVRFWTWEAFAHGAEAVCYFRWRQAP
FAQEQLHAGLLRPDSAETPAMIEARQVAEELTSADEVAPSQAPVALLFDYDAEWAWQVQP
HGKGLSYFDLVLDHYRALRRAGLSIDIVPPTQTDFTGYELILAPGLVHLPDDLRGALADA
TGLRLYGPRTAARDEDFRIPTSPLPPALQGLDIVVAAVESLRPDMPLPLANGDGAVVGYL
ETLDGEGSVLIETSAGHAVAVAADNQVYCAGWLDPLGLDHLIATLCARAGVNIRKMPEGV
RMRQTATEEFWFNHLAEPVETEVGTLPPAGILRRAREEA
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgcacacttggcacctgctactatccagaacattggccggaagacatctggcag
gaggacgccgcgcgcatggtcgcggcggggctgacctgggtccgcattggcgagttctcc
tggtcacgaatagaacccaaccccggtgatctgcaatgggactggctggatcgcgccatc
gacacattggtcgcggcgggattgaaagtggtgctgggcacccccaccgccaccccgccc
cggtggatggtggaccgccacccggatatgtttgcactcgatgcagatggcagatcgcgc
ggctttggctcgcgtcggcactattgtttcagccatacaggctaccgtgcagaggcccga
cggatcgtcaccctgatggcggaacgctacggcccgggcgatcgcatcgccgcatggcaa
acggacaatgaatacggctgccacgacaccacgataagctactccccggccgcagccgcc
gccttcacccactggcttgaggtccgtttcaacggtgacatttgcgcgctgaacgctgcc
tgggggaacgtgttctggtcgatggagtatgagcgctttgaccagatcggtctgccgaac
ctcaccgtgaccgaaccaaaccctgcccatgtccaggcatttaggcggttttcatcggac
caggttgtcagcttcaaccgcgatcaggtggagatcctgcgcgcccattccgacgcgccg
attgcgcataactatatgggacgagtaaccgactttgaccactacaaggtcggagaggat
ctggagatcgccagctgggacagctacccgttgggctttctagaggaccgggttggtgcc
agtgccgaggatcagcgccggtatgcgcgacagggtgacccggattttcaggcctttcat
catgacctctaccgtgccgtggggcgcgggcgttggtgggtgatggaacagcagcccggc
ccggtaaactgggcgccctacaatcccgctcccctgcccggcatggtgcggttctggacc
tgggaggcctttgcccatggagcggaggcggtctgctatttccgctggcgccaggcccct
tttgcgcaggagcaactccatgccggattgctgcgtcccgatagtgcagagacccccgcc
atgatcgaggcccgtcaggttgccgaagaactgacaagcgcagatgaggttgcgccatcg
caggctcctgtggcgctgctcttcgactatgatgcagaatgggcctggcaggtgcagcca
catggtaaaggtctgagttacttcgaccttgtgctggatcactaccgagccctgcgtcgc
gcgggtctgtctattgacatcgttccgccgacccaaaccgatttcaccggatatgagctg
atccttgcccctggtctggtacacctaccggatgacctgcgtggggcactggccgacgcg
acaggtctgcgcctctatggtccgcgaacagctgcgcgggatgaggatttcaggattcca
acctcgccgctaccgcctgccctgcaggggctggatattgtcgtcgcagcggtcgaaagc
ctccgaccggatatgccgctgccactcgcaaacggcgacggcgcagttgtcggctatctg
gaaacactggatggcgagggaagtgttctgatcgaaacctcagctgggcacgctgtcgct
gtcgctgcggacaatcaggtctattgtgccgggtggctggatccgttgggcctagatcac
ttgatcgcaacgctctgcgcccgtgcgggcgtgaacatccgcaaaatgcccgagggtgta
cgtatgcgccagaccgcgacggaggaattctggttcaaccacctcgccgagccggtagaa
acagaagtcggcacgctcccgcctgcaggaatcctgcgcagggcgcgcgaagaggcctaa

DBGET integrated database retrieval system