KEGG   Phaeobacter gallaeciensis DSM 17395: PGA1_c07390Help
Entry
PGA1_c07390       CDS       T02192                                 

Gene name
rafA
Definition
alpha-galactosidase RafA (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
pga  Phaeobacter gallaeciensis DSM 17395
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pga00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:pga00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:pga00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(761587..763686)
Genome map
AA seq 699 aa AA seqDB search
MSTVRDIRCWTLHDQRQSLILAAHGTDLAEVIYWGPRLPDGTDLEMLVAATRMDVTGGML
DAVPPLSICPEARRSFPGQPGLSLTNSAGEALLPRFTFERAEEDDQTLTLLYHDAKNGLR
YRARFELTLATGMIRATASLTSEQPVSVNWLSAPVFPAPQNSHEMIDFHGRWIGEFQTSR
TPWSVGARLRDNPTGRTGHEHFPGLIVPCTGATNSQGSAYAFHYGWSGGHKMLAEELPDG
RRQIQWGHATGSRRSPGTQFETAPLYAVFSDQGINGCAIAFQRHLRDEILQPPTPARPRP
VHYNCWEAVYFDHDHATLCDIASRAAALGAERFVLDDGWFGRRDDDTTSLGDWTIDRRKY
PDGLMPLINHVHAEGMTFGIWFEPEMINSDSDLFRAHPDWVLGDPDQVLGRQQMVLNIAL
PEVQAYLYERISAVLADHPIDYVKWDHNRVLPEPDSAQAEAIYVLFDRLRADFPTVEFES
CSSGGGRIDFGILSRTHRVWLSDSNDPLERLRIQHEAALFLPMVVTGSHVGPRKCHTSGR
VTDIRLRAWVAAQRHMGFEMDPRELTEEEADVLRQVTRWWKGNRHWTERADILRLDSDDP
AVIAELQRAEDGSRFVAFAGLSAASAQILPRPLRLTGLDPGTLYEISLLNRDDAPGLSRG
SPLLKTETARLSGQYLMHQGITLPWTFPQSIWVIEGTRL
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacggtgagagatatccgctgttggacacttcacgatcagaggcaaagcctgatc
ctcgccgcccatggcacagatttggcggaggtcatttactggggaccgcgcctgccggat
ggcaccgatctggaaatgcttgttgccgctacgcgcatggatgtgacgggggggatgctg
gacgccgtgccgccgctgtcgatctgccccgaggcgcgccgcagctttcccggccagccc
ggcctgtcactgacgaacagcgcaggcgaggcgctgttgccccgcttcacctttgaacgt
gccgaggaagatgatcagaccctcacccttctgtatcacgatgcgaaaaacgggctgcgc
tatcgcgcgcggttcgagctgacgctcgcaacaggcatgatccgcgcgacggcctctctc
acgtcagagcagccagtcagtgtgaactggctctctgcaccggtctttccggcacctcag
aacagtcacgagatgatcgacttccacggccgctggatcggagagtttcagaccagccgc
acgccctggagcgttggcgcgcgcctcagggacaaccccacagggcgcaccgggcatgag
catttccccggtctgatcgtgccctgcaccggtgccacgaacagccaaggatctgcctat
gcctttcactacggctggtctggtggccataaaatgctggcagaggaactgcccgacggg
cgtcgccagatccaatggggacatgcgaccggcagccgccgcagccccggcacccagttt
gaaaccgcaccgctctatgccgtgttctcggatcaggggatcaatggctgcgccattgcc
ttccagcgtcatctgcgtgacgagatcctgcagccccctacacctgcgcgcccgcgaccg
gtgcattacaactgctgggaagcggtatatttcgaccatgatcacgccacgctctgcgat
attgcaagccgggctgcggcactaggggcagagcggtttgtgttggatgatggctggttc
ggcagacgggatgacgataccacatcgctcggcgattggacaattgacagacgcaaatac
cccgatgggctgatgcccctgatcaaccacgtgcacgcagaaggcatgacatttggcatc
tggtttgagccggaaatgatcaactcggacagcgatctgtttcgcgcccatcctgattgg
gttctgggcgatcctgatcaggtcctaggcagacagcagatggtgctgaatatcgcgctg
ccagaggttcaggcctatctctacgagcgcatctcagccgtacttgccgaccatcccatc
gactatgtgaaatgggatcacaatcgcgtcctcccggaaccagacagcgcgcaggccgag
gcgatttatgtgctctttgacaggctgcgggcagacttccctacggtggagtttgaaagt
tgttcatcaggtggcgggcgtattgactttggcatcctgtcgcgcacccaccgcgtctgg
ctctctgacagcaacgacccgcttgagcgattgcgcatccagcatgaagccgcgcttttc
ctgccgatggtggtcaccggcagccacgtaggcccccgaaaatgccacacctctggccgg
gtgacagacatccgcctgcgcgcctgggtcgcggcgcagcgccatatgggctttgaaatg
gacccgcgcgagctgaccgaggaggaagcagacgttctgcgccaggttacccgctggtgg
aaaggcaatcgtcattggacagagcgggcggatattctacggctcgacagcgacgatcct
gcggtcattgcggagttgcagcgcgcggaggatggcagtcggttcgtcgccttcgccggg
ctgagcgcggccagtgcccagatcctgccccgccctctgcgcctgaccgggctggacccg
ggtacactgtatgaaatcagcctgctgaaccgcgacgatgcccccggcctgtcgcgtggc
tcgccgctcctgaaaaccgaaaccgcccgtctcagcggccaatatctgatgcaccaaggg
atcaccctgccctggaccttcccgcagtcgatatgggtgattgaaggaacacgcctatga

DBGET integrated database retrieval system