KEGG   Phaeobacter gallaeciensis DSM 17395: PGA1_c09520Help
Entry
PGA1_c09520       CDS       T02192                                 

Gene name
murE
Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase MurE (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
pga  Phaeobacter gallaeciensis DSM 17395
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:pga00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:pga00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
975656..977140
Genome map
AA seq 494 aa AA seqDB search
MSTIENRPLSQLGLTARGGVDPMIRGIAVDSRKVVEGGLFAALPGSQVHGAKFTPAALGN
GAAAILTDAAGAQIVAQLLRESTVALVVVEDPRQALAYAAALWFGAQPETMVAVTGTNGK
TSVASFVRQIWVELGHQAVNLGTTGVEGSWSHPLNHTTPEPVTLHDALAQAAAAGVTHAA
MEASSHGLEQRRLDGVHLAAAGFTNFTQDHLDYHETFEAYFTAKAGLFRRVLPDDGVAVI
NMDDPRGEQMRAVAAARGHEVISVGRGLGDLSLVGARYDASGQDMRFTWHDKPYQARLNL
IGGFQAENILLACGLVIASGEDPQAVFDTLPHLQTVRGRMQLAATRENGATVFVDYAHTP
DAVATAIKALRPHVLGRLVAIVGAGGDRDAAKRPLMGQAAQNNADLVIVTDDNPRSEDPA
VIRAAVKGGAPDAMEVGDRAEAILRGVDALGAGDALLICGKGHETGQIVGSDVLPFDDVE
QASMAVAVLDGRLV
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccattgaaaaccgtcctctcagccagttggggctgaccgcgcgtggcggtgtc
gatccgatgatccggggcattgccgtggacagccgcaaggtggtcgaaggcgggctgttt
gcagcccttcccggcagtcaggtgcatggggcgaaattcacccccgcagcacttggcaac
ggggcggcggcgatcctgaccgatgcggccggggcgcagatcgtagcacagctgctgcgc
gagtcgaccgtggctctggtggttgtcgaagatccgcgtcaggcgctggcctatgccgcg
gccctgtggttcggcgcgcagcctgaaaccatggtggcggtcaccggcaccaatgggaaa
acttcggtggccagctttgtgcgccagatctgggtcgagctgggccatcaggcggtgaac
ctcggcaccacgggcgttgaaggcagctggagccacccgctcaatcacaccacacccgaa
cctgtcaccctgcatgatgcgctggcgcaggcggcggctgcgggtgtcacccatgccgcg
atggaggcctcgtctcacgggttggagcagcggcgtctggacggtgtgcatctggcggcg
gcggggttcactaatttcacccaggaccacctcgattaccacgagacgtttgaggcgtat
ttcaccgccaaggccggcctgttccgtcgggtgctgccggatgatggcgtggccgtcatc
aacatggatgatccccgcggtgagcagatgcgggcggtcgctgcggcgcgcgggcatgag
gtgatttcggtcgggcgcggtctcggtgatctgagccttgtcggtgcgcgctatgatgcg
tccggtcaggacatgcgcttcacctggcacgacaaaccctatcaggcgcggctgaatttg
attggcgggtttcaggcggagaatatccttctggcctgcggtctggtgattgccagcggc
gaggacccgcaggcggtgtttgacacgctgccgcatctgcagaccgtacgcgggcggatg
cagctggcggccacgcgcgaaaatggcgcgacggtttttgtggattacgcccataccccc
gatgccgtggccaccgcgatcaaggcgttgcgcccgcatgtgctgggccggttggtggcc
attgtcggcgccggtggtgatcgcgatgccgccaaacgtccgctgatggggcaggcggcg
cagaataacgccgatctggtgatcgtcactgacgacaatccgcgcagcgaggatccggcg
gtgatccgtgccgccgtcaagggcggcgcgccggacgcgatggaagtcggcgaccgggcc
gaggcgattctgcgcggtgtggatgcgttgggggcgggcgatgcgctgctgatctgcggc
aaggggcatgagacgggtcagatcgtcggcagtgatgttttgccctttgatgatgtggag
caggccagcatggcggtcgcggtgctggacgggaggctggtatga

DBGET integrated database retrieval system