KEGG   Phaeobacter gallaeciensis DSM 17395: PGA1_c09900Help
Entry
PGA1_c09900       CDS       T02192                                 

Gene name
glcB
Definition
malate synthase GlcB (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
pga  Phaeobacter gallaeciensis DSM 17395
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pga01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pga00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:pga00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1023234..1025366
Genome map
AA seq 710 aa AA seqDB search
MSGMQERHDMQVADTLVSFIEDKALPGTGVTADAFWAGLAGLVNGMGDENRALLAKRADL
QGQIDAWHIERKGQAHDATAYEAFLRDIGYLLPEGDDFEIETQNVDDEIANVPGPQLVVP
ITNARFALNAANARWGSLYDALYGTDAMGDLPEGKGYDAGRGARVIAWGRGFLDQTFPLA
EGSWNDCVGLSVEGGALVPALKDAAQFAGYEGDAATPGKILLKNNGLHAVIVVDANGNIG
KGDQAGINDIVLESALSTIMDCEDSVACVDGEDKVTAYANWLGLMKRDLAEEVTKGGETF
TRVLNDDQTFTAPDGSDLVLKGRSLLLVRNVGHLMTNPAVRDSAGREAGEGFIDAMVTVL
CAMHDLQAEGGNSLHGSVYVVKPKMHGPEEVAFTDRIFTHVEDALGLPRHTVKIGIMDEE
RRTSVNLKSCIRAAKHRVAFINTGFLDRTGDEIHTSMEAGAMMRKGEMKSTPWIASYEDR
NVDIGLACGLKGRAQIGKGMWAMPDRMGEMLEAKIGHPKSGATCAWVPSPTAATLHATHY
HRVNVHEVQDQLKAGGARGTLDDLLTIPVMQGENLSDAEIAQEIENNAQGILGYVVRWVD
QGVGCSKVPDIHNVGLMEDRATCRISSQALANWLHHGIVDETQVMAAMQKMAAVVDGQNA
SDASYTPMAPGFDGIAFQAACDLVFRGRIQPSGYTEPVLHARRLELKAQG
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggatgcaggaacgtcatgatatgcaggtggctgacacgctggtgtcctttatc
gaggacaaagcgctgcccggcactggtgtaacagcggatgcgttctgggccggtctggct
ggcctggtcaatggcatgggggatgaaaaccgtgcccttctggcaaaacgtgccgatctg
caggggcagattgacgcctggcatatcgaacgcaaagggcaggcccatgacgccaccgcc
tacgaggcgtttctgcgcgatatcggctacctgctacccgagggcgatgactttgagatc
gagacgcagaatgttgacgatgaaatcgccaatgttccggggccgcagctggtggttccg
atcaccaacgcgcgctttgcgctgaatgcggccaatgcgcgttggggcagcctctatgat
gcgctctatggcaccgatgccatgggcgatctgcctgagggcaaaggctatgacgccggg
cgcggtgcgcgggtgatcgcctggggtcgcgggttccttgatcagactttcccgctggct
gaggggtcgtggaacgattgtgtcggcctgtcggtggagggcggcgcgctggtgcctgcg
ctcaaagacgccgcgcagtttgcgggctatgaaggcgatgccgccacgccgggtaagatc
ctgttgaagaacaatggcctgcacgcggtgattgtcgtggatgccaacgggaatatcggc
aagggcgatcaggcggggatcaatgatatcgtcctcgagtccgcgctctcgaccatcatg
gattgcgaagattccgtggcctgcgtcgatggtgaggacaaggttactgcctatgcgaac
tggcttgggctgatgaagcgggatctggctgaagaggtgacaaagggtggtgaaaccttc
acccgtgtgctgaacgacgaccagacgttcaccgcaccggatggctcggatctggtgctg
aaggggcgctcgctgctgctggtgcgcaacgtcggccatctgatgaccaaccccgccgtt
cgcgacagcgccgggcgcgaggcgggcgagggcttcattgatgcgatggtcaccgttcta
tgtgcgatgcatgatcttcaggctgagggtggcaactcactgcatggctcggtctatgtg
gtgaagcccaagatgcacggacccgaagaggttgctttcaccgaccggattttcacccat
gtcgaagacgcgctgggcttgccgcgtcacaccgtcaagatcggcatcatggacgaagag
cgtcgtacttcggtgaacctcaaatcctgtatccgggccgcaaaacatcgggttgccttc
attaatacaggcttccttgaccggaccggcgatgagatccacacctcaatggaagcgggt
gcgatgatgcgcaagggcgagatgaaatcgacgccctggattgcctcttacgaggatcgc
aatgtcgatatcggactggcctgtggtttgaaagggcgcgcccagatcggcaaggggatg
tgggcgatgccggaccgtatgggcgagatgctggaggctaagatcggccatccgaagtcc
ggcgcgacctgtgcctgggtgccgtcgccgaccgccgcgacgctgcatgcgacgcattac
catcgcgtgaatgtccacgaggtccaggaccagctgaaagcgggcggcgcgcggggcacg
ctggatgatctgctgacaattccggtgatgcagggcgagaacctgtcggatgcggagatc
gcgcaggagatcgagaacaacgcacagggcattctgggctatgtggtgcgctgggttgat
cagggcgtggggtgctccaaggtgcctgacattcacaatgtcggcctgatggaagaccgt
gcgacttgccggatttccagtcaggcgctggccaactggttgcatcatggcatcgtggac
gaaacacaggtcatggccgcgatgcagaaaatggccgcagtcgtggacggacagaatgcg
agcgacgccagctacacgccaatggcaccgggatttgatggaattgcctttcaggcggcc
tgcgatctggtgttccgcggtcgtattcagccctccggctataccgagccggtgctgcat
gcgcgccgccttgaactgaaggcgcaaggctaa

DBGET integrated database retrieval system