KEGG   Phaeobacter gallaeciensis DSM 17395: PGA1_c11160Help
Entry
PGA1_c11160       CDS       T02192                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pga  Phaeobacter gallaeciensis DSM 17395
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pga00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:pga00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1154406..1155410
Genome map
AA seq 334 aa AA seqDB search
MRYGATILDAEGLRLSAAEKALFARANPFGFILFARNIDSAEQTRALCNDLREAVGRDCL
ITIDQEGGRVQRLRPPLARQWQPALDHASVAGAGATRAMYLRARLIADELRGLGIDSNCA
PLADVAGEGTHPFLKNRCYGTDLTTVVTRARATAEGLLDGGVVPVVKHIPGHGRASMDSH
HDLPRITASLADLAREDFAAFAALNDLPMGMTAHLVYETLDSEPATLSSRIMQMIRSDIG
FDGLIMSDDISMKALQGTAADIARDTIAAGCDVVLFCNAPLDDRAAVAEAAGEMTDAAQA
RAERAEAARRTPAALDIPTAEAELSALMGGQVYG
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgcgttacggagccaccatattagatgccgaaggcctgcgtctcagcgccgccgaaaag
gcgctgttcgcccgcgccaacccttttggctttatcctgtttgcccgcaatatcgacagt
gccgaacagacccgtgcgctttgcaatgacctgcgcgaggcggtgggacgtgactgtctg
atcaccatcgaccaagagggcggccgggtgcagcgtctgcgcccgccactggcgcgccaa
tggcagccagcgctggatcacgcgtctgttgcgggggcaggtgcaacccgcgccatgtat
ctgcgcgcgcggctgattgcggatgaattgcgcgggcttggcatcgacagcaactgcgcg
ccgctggcggatgtggcgggcgaggggacgcatcccttcctcaaaaaccgttgctatggc
accgatctgaccaccgtcgtcacccgcgcccgcgccacggctgaagggctgttggacggc
ggcgttgtaccggtggtgaaacacatccccggccatggtcgtgccagcatggatagccac
catgatctcccccggatcaccgcctctctcgccgatctggcgcgggaggatttcgccgct
tttgccgcgctgaacgatctgccgatggggatgacagcccatctggtatacgagacactc
gacagcgaacccgccactttgtcatcccgtatcatgcagatgatccgttcggacatcggc
tttgacgggttgattatgagcgacgatatctcgatgaaggcgctgcaaggcacagccgca
gacattgcccgcgacaccatcgcggccggctgcgatgtggtcctgttctgtaacgccccg
ctggacgaccgtgccgccgtggcggaggccgctggcgagatgaccgacgccgcacaggca
cgcgccgagcgcgccgaagccgcccgccgcacgcccgccgcgcttgacatacccacggcc
gaggccgaactatcagccctcatgggcggacaggtatatggctga

DBGET integrated database retrieval system