KEGG   Phaeobacter inhibens: PGA1_c12020Help
Entry
PGA1_c12020       CDS       T02192                                 

Gene name
fadJ
Definition
fatty acid oxidation complex FadJ subunit alpha (EC:1.1.1.35 4.2.1.17)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
pga  Phaeobacter inhibens
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PGA1_c12020 (fadJ)
   01212 Fatty acid metabolism
    PGA1_c12020 (fadJ)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PGA1_c12020 (fadJ)
   00650 Butanoate metabolism
    PGA1_c12020 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    PGA1_c12020 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    PGA1_c12020 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PGA1_c12020 (fadJ)
   00310 Lysine degradation
    PGA1_c12020 (fadJ)
   00380 Tryptophan metabolism
    PGA1_c12020 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PGA1_c12020 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PGA1_c12020 (fadJ)
   00281 Geraniol degradation
    PGA1_c12020 (fadJ)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    PGA1_c12020 (fadJ)
Enzymes [BR:pga01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     PGA1_c12020 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PGA1_c12020 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     PGA1_c12020 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1249462..1251663)
Genome map
AA seq 733 aa AA seqDB search
MSDFTMKKDADGVAIITWDCPGKTMNVLNGQAMIDLDGLVDDALADDAVKGIVITSGKKD
FAGGMDLNVLAKMKEDAGDEPARGLFEGIMKMHEGLRKIERAGMDPKTNKGGKPVAAALP
GTAVGIGLELPLSTHRIFAADNPKAKIGLPEIMVGIFPGAGGTTRLVRKMGAMAAAPFLL
EGKLVDPKKAKGAGIIDEVVEDPLAAARAWVLEAKDADIVKPWDAKGYKMPGGAPYHPAG
FMTFLGAAAMVHGKTFGAFPAAKALLSAVYEGALVPFDTALKIEARWFTHVLMNPSSEAM
IRSLFLNKEALEKGAVRPAGIEDQSVKKIGVLGAGMMGAGIALVSAQAGMEVVLIDRDQA
AADKGKAYTESYLDKGIKRGKVTADKKEAMLSRITATPDLDHLKGCDLIIEAVFEDPGVK
AEMTKKVEAIIPEDCIFASNTSTLPITDLAEASVRPEQFIGIHFFSPVEKMFLVEIIKGE
KTGDRAVAKALDYVRQIRKTPIVVNDARFFYCNRCIIPYVNEGARMITEGVAPALIDNAA
RQLGFPVGPIQLTDETSIDLGAKIARATKAAMGDAYPESAADDLIFWMEEQGRLGRKSNA
GFFDYDDKGKRQGYWKGMQEKYPLADEQPDLIEVQERLMFAQVLEAVRALEEGVLMDIRE
GDVGAILAWGFAPWSGGPLSWLDIIGTPYAAERCDQLTAKYGERFTCPPLLREMAEKGQT
FYGRFNPEASKAA
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatttcacaatgaagaaagacgccgacggcgtcgccatcatcacctgggactgc
cccggaaaaaccatgaacgtgctgaacggccaggcgatgatcgaccttgatggtctggtc
gatgacgcgctggccgatgacgcggtcaagggcatcgtgatcacctctggcaagaaagac
tttgccggtggcatggatctgaacgtgctcgccaagatgaaagaggatgccggtgacgag
cccgcgcggggcctgttcgaaggcatcatgaaaatgcacgaaggtctgcgcaagatcgag
cgtgccggcatggatcccaagaccaacaagggtggcaaaccggtggcagcagccctgccc
ggcaccgctgttggcatcggtctggaactgccgctgtccacacatcgcatctttgccgca
gacaaccccaaggcaaaaatcggcctgccggagattatggttggcatcttccccggtgca
ggcggcaccacccgtctggtgcgcaagatgggcgccatggcggcggcccccttcctgctg
gaaggcaaactggtcgaccccaagaaagccaaaggtgctggcatcatcgacgaggttgtc
gaagacccgctggccgcagcccgcgcctgggttctggaggcaaaagacgccgatatcgtc
aagccctgggacgccaagggttacaaaatgcctggtggcgcgccctatcatcctgcgggc
ttcatgaccttccttggtgcggcagccatggtgcatggcaaaacatttggcgccttcccg
gcagccaaggcgctgctgagtgcggtctatgaaggcgcgctcgtgccattcgatacagcg
ctgaagattgaggcgcgctggttcacccatgtgttgatgaacccttcgtccgaggcaatg
atccgttcgctcttcctcaacaaggaagcgctggaaaaaggcgcagtgcgtcctgcgggt
attgaggatcagtcggtcaagaagatcggcgttctgggcgctggcatgatgggggccggt
atcgcgctggtctccgctcaggccgggatggaggttgttctgatcgaccgtgatcaggct
gccgccgacaagggcaaggcctataccgaaagctatctcgacaagggcatcaagcgcggc
aaagtcacggccgacaaaaaagaggcgatgctgtcacgcatcaccgcaacccctgatctg
gaccacctcaagggctgcgatctgatcattgaggcggtgttcgaagatccaggtgtcaaa
gccgagatgaccaagaaggtcgaggcgatcatccccgaggattgcatctttgcctccaac
acctcgaccctgccgatcacggatctggcagaggcctcggtgcgcccggagcagttcatc
ggcattcacttcttctcgccggtggaaaaaatgttcctggtggagatcatcaagggtgag
aaaaccggggatcgcgcggtggccaaggctctggattatgtgcgccagatccgcaagacc
ccgatcgtggtcaatgatgcgcggttcttttactgcaaccgctgcatcatcccctacgtg
aacgaaggcgcacgcatgatcaccgagggcgttgcccccgcgctgatcgacaatgccgcg
cgtcagctgggcttccctgtgggtccgatccaattgaccgatgagacctcgattgatctg
ggtgccaagatcgctcgtgccaccaaggcggcgatgggcgatgcttatcccgaaagcgct
gcggatgatctgatcttctggatggaagaacagggccgtctgggacgcaagtccaacgct
ggtttcttcgactatgacgacaagggcaagcgtcaggggtactggaagggcatgcaggaa
aaatatccgctggccgacgaacagcctgatctgattgaggtgcaggaacgcctgatgttc
gcacaggttctggaagccgtacgggcgctggaagaaggtgttctaatggacatccgcgaa
ggggacgttggcgccattctggcctggggctttgcgccctggtccggtggcccgctgagc
tggctcgacatcatcggcacgccctatgcggccgaacgttgtgatcagctgaccgcaaaa
tacggcgaacgcttcacctgcccgccgctgctgcgggagatggcggagaaaggccagacc
ttctacggtcgcttcaacccggaggccagcaaggctgcctga

DBGET integrated database retrieval system