KEGG   Phaeobacter inhibens DSM 17395: PGA1_c12030Help
Entry
PGA1_c12030       CDS       T02192                                 

Gene name
fadA2
Definition
(GenBank) 3-ketoacyl-CoA thiolase FadA
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pga  Phaeobacter inhibens DSM 17395
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Module
Ethylmalonyl pathway
Brite
KEGG Orthology (KO) [BR:pga00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PGA1_c12030 (fadA2)
   00630 Glyoxylate and dicarboxylate metabolism
    PGA1_c12030 (fadA2)
   00640 Propanoate metabolism
    PGA1_c12030 (fadA2)
   00650 Butanoate metabolism
    PGA1_c12030 (fadA2)
  Lipid metabolism
   00071 Fatty acid degradation
    PGA1_c12030 (fadA2)
   00072 Synthesis and degradation of ketone bodies
    PGA1_c12030 (fadA2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PGA1_c12030 (fadA2)
   00310 Lysine degradation
    PGA1_c12030 (fadA2)
   00380 Tryptophan metabolism
    PGA1_c12030 (fadA2)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PGA1_c12030 (fadA2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PGA1_c12030 (fadA2)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PGA1_c12030 (fadA2)
Enzymes [BR:pga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PGA1_c12030 (fadA2)
Exosome [BR:pga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PGA1_c12030 (fadA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1251687..1252898)
Genome map
AA seq 403 aa AA seqDB search
MTEAYIYDAVRTPRGKGRKDGSLHEVTAARLSAVALNALKDRNNLEGHAVEDVIWGNVTQ
VGEQGACLARTAVLASDLDESIPGVSINRFCASGLEAVNMAANQVRGRAGHAYIAGGVES
MSRVPMGMDGGAIAVDPAIAIENYFVPQGISADIIATEYGFSRDDADAMAMESQRRAKAA
WDDNRFAGSIVPVRDINGLTILDHDEYMRPGTDMQSLGGLNPAFQMMGEQMPGFDKIAML
KYPHLERINHIHHAGNSSGIVDGAAAVLIGDKEFGEAMGLKPRARIKATAKIGTDPTIML
TGPVPVTEKILRDNGMAIGDIDLFEVNEAFASVVMRFEQAFGVDHDKVNVNGGSIAMGHP
LGATGAMILGALLDELERSDRETGLATLCIGSGMGAATIIERV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagcctatatctatgacgctgtgcgcaccccgcgcggcaagggtcgcaaggat
gggtccttgcatgaagtgacagccgcgcgactgtcggcagtggctctcaacgctctgaaa
gaccgaaacaatctggaaggccacgcagttgaggacgtgatctggggcaatgtcacccag
gtcggtgaacagggcgcctgcctggcgcggaccgctgttctggcctctgacttggatgaa
tccatcccaggtgtctccatcaaccgtttctgcgcctcgggtctggaagctgtcaacatg
gctgccaaccaggtgcgtggccgcgccggtcacgcctatatcgcgggcggtgtggaatct
atgagccgcgttcccatgggcatggacggtggtgccatcgcggttgatcccgccatcgcc
atcgagaactattttgtcccgcagggcatctccgccgatatcatcgcgactgaatacgga
ttctcgcgcgacgatgccgacgccatggcaatggaatctcagcgccgggccaaggcggca
tgggacgacaatcgctttgccggcagcatcgtacccgtgcgcgacatcaacggcctgacc
attctggaccacgatgagtacatgcgccccggcaccgatatgcaatcgctgggcggtctg
aaccccgcgtttcagatgatgggcgagcagatgcctggcttcgacaagatcgcaatgctg
aaatatccgcatctggagcggatcaatcacattcaccacgcaggcaactcttccggtatc
gtggatggcgccgctgccgtactgatcggcgacaaagagtttggcgaggcgatgggtctg
aagccgcgggcacggatcaaagctacggccaaaatcggtaccgaccccacgatcatgctg
accggccctgtgcctgttacagaaaagatcctgcgcgacaacggcatggcaattggcgac
atcgacctgtttgaggtcaatgaagccttcgccagtgttgtgatgcggttcgagcaggcc
tttggcgtggaccatgacaaggtgaacgtcaacggtgggtctattgcgatgggtcacccg
ctgggtgccaccggtgccatgatcctcggcgcactgttggatgagctggagcgcagcgac
cgtgaaaccggcctggcaacgctctgcatcgggtccggcatgggcgcggccaccatcatt
gaacgcgtgtaa

DBGET integrated database retrieval system