KEGG   Phaeobacter inhibens: PGA1_c13150Help
Entry
PGA1_c13150       CDS       T02192                                 

Definition
di-heme cytochrome c peroxidase-like protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
pga  Phaeobacter inhibens
Brite
Enzymes [BR:pga01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     PGA1_c13150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1359716..1361515
Genome map
AA seq 599 aa AA seqDB search
MRLIDLCRGHLLDHFFQADGRIGIAADGRQRVPHIGAHQIGGWHSATDFIVPANSGLGAR
MPFHGAAQVPLKRTDIVLLNTQPHGVHNPDQFFRIGIAGSRRWPKRIMRRRKLPGLHQVA
GLLDFRPGWQRRSYCQAGHGQRHRDQNRFPSLAHVLSCVVLALGLCAGAAMAEDPQLPSS
LGPGDFIPVDPAKAELGRLLFYDKILSGNRNISCGTCHHPRHGTSDGLSLGLGEGAEGLG
PARLSGRGASRVQKRVPRNAPALWNLGAKSIRVLMHDGRISADPIYGNSFNTPAEEWLLG
GLQSLLAAQALFPMTSSVEMAGNVGENEVIGATRDRIDLAWPIIAKRVRSLPDYGVGFVA
AFDHISVPEDVEVTDIAEALAQFMVQDFTSVDSPFDAYLAGNDTALTARQKAGADLFFGS
AGCSGCHAGPLFSDQNFYALGLPAFGPGRARRFDPYARDVGRMGESDDLADAYRFRTPML
RNVELTGPYGHNGAFPTLERMIRHHLDPVASRSAWTPDDLQLPDVPWLAATDFVVQQDRF
EMARQARARDIYLRQDLSDQDIAALVAFLTALTGEKARAQQSSVPSAVPSGLPVDGAKR
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgcgccttatcgatctctgccggggtcatcttcttgaccacttcttccaggctgatggc
cgcatcgggatcgccgccgatggccgacagcgtgtaccacatataggcgcgcaccagatc
gggggctggcattccgcgaccgatttcatagtaccagccaattccggattgggcgcccgg
atgccctttcatggcgctgcgcaggtaccactcaaacgcacggacatcgtcctgctcaac
acccagccccatggcgtacataaccccgatcagttcttccgcatcggcattgccggatcg
cgccgctggccaaagcgcatcatgcgccgccgcaaactgcccggcctccatcaggtcgcg
ggcctgctcgatttccgcccaggctggcagaggcgcagttattgtcaggccggtcatgga
cagcgccaccgcgaccagaaccggtttccatctcttgcgcatgtgctctcctgtgtcgtg
ttggcgcttggcctttgtgcgggggcggctatggcagaggacccgcagttgccgtcatcg
ctggggcccggcgattttatacccgtagacccggcaaaggcggaactggggcgactgcta
ttttatgacaagatcctgtcggggaacagaaatatcagctgcggcacctgccatcatcca
cgtcatggtacatctgatgggctgtcgctggggctgggtgagggggctgaggggctggga
cctgcgcgcctgtccggccgcggcgcaagccgggtgcagaaacgtgtgccgcgcaatgcg
ccagcactttggaacctcggggcgaagtccattcgcgtgctgatgcatgatgggcggatc
agtgcagatcccatttacggcaatagcttcaacaccccagccgaggaatggttgcttggg
gggctgcaatcgctgctggctgcgcaggccttattcccgatgacttccagcgtcgagatg
gcaggcaatgtcggcgagaacgaggtgataggggccacccgcgaccggattgatctggcc
tggccgatcatcgccaaacgcgtccgcagtcttccggactatggagtggggttcgttgct
gcctttgatcacatctcagtaccggaggatgtggaagtcacagatattgccgaggcgctt
gcccagttcatggtgcaggatttcacctcggttgatagcccgtttgatgcctatctggcg
gggaatgacaccgccctgaccgcgcgacagaaagccggggcggacctgttctttggctct
gccggatgcagcgggtgccatgctgggccgctgttttcggatcagaacttctacgccctc
ggtctgccggccttcggccccggtcgcgcgcgccgctttgacccttatgcccgggacgtc
ggtcgtatgggcgaaagcgatgatctggcagacgcctaccggttccgcacgcctatgttg
cgcaatgtggaactgaccggcccttatggccacaacggagctttcccgacactggagcgg
atgatccggcaccatctcgatccagtcgcaagccgttcggcgtggacgcctgacgatctg
caattgccagatgtgccctggctggccgccacagattttgtggtgcagcaggaccggttc
gagatggcgcgccaggcgcgggcccgcgacatatatctgcgccaggatctcagcgatcag
gatatcgcagcgctggtcgcctttctcacggcgctgaccggcgaaaaagcacgcgcacag
caatcgtctgtcccctccgccgttcccagcggcctgcccgttgatggggcaaagcgctga

DBGET integrated database retrieval system